pcnA Resolved · high auto-curated

H37Rv Rv3907c · MTBC0 - · 480 aa · 4391631–4393073 (-) · RefSeq YP_178026.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)poly(A) polymerase PcnA
MTBC0 PGAP re-annotation
Revised (this work)Poly(A) polymerase PcnA. Pfam: PolyA_pol (PF01743.27), PolyA_pol_RNAbd (PF12627.13), HD (PF01966.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N672 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable poly(A) polymerase PcnA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namepcnA
eggNOG descriptionpoly(A) polymerase
Orthologous groupCOG0617
EC number EC 2.7.7.19, EC 2.7.7.72
KEGG orthology K00970, K00974
KEGG pathways map03013, map03018

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PolyA_polPF01743.27 4.6e-3339–165 Poly A polymerase head domain
PolyA_pol_RNAbdPF12627.13 6.3e-18193–252 Probable RNA and SrmB- binding site of polymerase A
HDPF01966.29 4.6e-15268–366 HD domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mutT4 (mutator protein MutT), medium confidence from genomic context alone (score 689 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3906c hyp hypothetical protein 851 851 ctx neighborhood:849
Rv2773c dapB 4-hydroxy-tetrahydrodipicolinate reductase 779 779 coexpression:761
Rv3908 mutT4 mutator protein MutT 689 689 ctx neighborhood:679
Rv3909 hyp hypothetical protein 682 682 ctx neighborhood:679
Rv3910 murJ peptidoglycan biosynthesis protein 680 680 ctx neighborhood:679
Rv3219 whiB1 transcriptional regulator WhiB1 640 640 ctx cooccurence:640
Rv3905c esxF ESAT-6 like protein EsxF 588 589 ctx neighborhood:586
Rv3904c esxE ESAT-6 like protein EsxE 585 585 ctx neighborhood:582
Rv3903c cpnT hyp hypothetical protein 584 584 ctx neighborhood:583
Rv3902c ift hyp hypothetical protein 583 583 ctx neighborhood:582
Rv3441c mrsA phosphoglucosamine mutase 590 571 ctx fusion:552
Rv2783c gpsI bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 826 570 experimental:462 textmining:614
Rv3260c whiB2 transcriptional regulator WhiB2 556 556 ctx cooccurence:555
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 526 526 coexpression:511
Rv1547 dnaE1 DNA polymerase III subunit alpha 514 512 ctx cooccurence:496

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): poly(A) polymerase PcnA
  • Pfam (hmmscan --cut_ga): PolyA_pol PF01743.27 (E=5e-33), PolyA_pol_RNAbd PF12627.13 (E=6e-18), HD PF01966.29 (E=5e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178026.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PolyA_pol (PF01743.27), PolyA_pol_RNAbd (PF12627.13), HD (PF01966.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0617
  • Curated reference: UniProt L7N672 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor mutT4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3907c|pcnA
MPEAVQEADLLTAAAVALNRHAALLRELGSVFAAAGHELYLVGGSVRDALLGRLSPDLDFTTDARPERVQEIVRPWADAVWDTGIEFGTVGVGKSDHRMEITTFRADSYDRVSRHPEVRFGDCLEGDLVRRDFTTNAMAVRVTATGPGEFLDPLGGLAALRAKVLDTPAAPSGSFGDDPLRMLRAARFVSQLGFAVAPRVRAAIEEMAPQLARISAERVAAELDKLLVGEDPAAGIDLMVQSGMGAVVLPEIGGMRMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDIGKPATRRHEPDGGVSFHHHEVVGAKMVRKRMRALKYSKQMIDDISQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGALLPRLHKLVRADCTTRNKRRAARLQASYDRLEERIAELAAQEDLDRVRPDLDGNQIMAVLDIPAGPQVGEAWRYLKELRLERGPLSTEEATTELLSWWKSRGNR