pcnA Resolved · high auto-curated

H37Rv Rv3907c · MTBC0 - · 480 aa · 4391631–4393073 H37Rv (-) · RefSeq YP_178026.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)poly(A) polymerase PcnA
MTBC0 PGAP re-annotation
Revised (this work)Poly(A) polymerase PcnA. Pfam: PolyA_pol (PF01743.27), PolyA_pol_RNAbd (PF12627.13), HD (PF01966.29).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 18 publications

18 TB publications mention this gene. 18 publication(s) discuss this gene (20 in a M. tuberculosis context).

Most recent 5 of 18.
PublicationDate
Association between overexpression of efflux pumps genes Rv0191 and Rv3008 and pyrazinamide resistance in multidrug-resistant Mycobacterium tuberculosis: a multi-center study. doi:10.1186/s12879-026-12793-x 2026
Adjuvant-induced arthritis induces epithelial proliferation and differential expression of SVS2 and SVS3 in the seminal vesicles. doi:10.1111/andr.70085 2026
Nucleotidyltransferase toxin MenT extends aminoacyl acceptor ends of serine tRNAs to control Mycobacterium tuberculosis growth. doi:10.1038/s41467-024-53931-w 2024
Characteristics of Serum Autoantibody Repertoire and Immune Subgroup Variation of Tuberculosis-Associated Obstructive Pulmonary Disease. doi:10.2147/COPD.S434601 2023
Depletion of tRNA CCA-adding enzyme in Mycobacterium tuberculosis leads to polyadenylation of transcripts and precursor tRNAs. doi:10.1038/s41598-023-47944-6 2023

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -8.54 (95% CI -8.86 to -8.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in transcription mechanism [catalytic activity: N ATP + (nucleotide)(M) = N diphosphate + (nucleotide)(M+N)].
Mycobrowser EC 2.7.7.19 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3937c · 99.8% identity
M. leprae ML2697c · 84.1% identity
M. marinum MMAR_5471 · 89.0% identity
M. smegmatis MSMEG_6926 · 82.5% identity
M. orygis RJtmp_004022 · 99.8% identity
M. abscessus MAB_4934c · 76.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt L7N672 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable poly(A) polymerase PcnA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namepcnA
eggNOG descriptionpoly(A) polymerase
Orthologous groupCOG0617
EC number EC 2.7.7.19, EC 2.7.7.72
KEGG orthology K00970, K00974
KEGG pathways map03013, map03018

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 86.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 61.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 20 in the ORF — 19 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.050, mean read count 68. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainpcnA-TetOn 10.3 (TetON promoter 10)
Baseline knockdown fitness4.583 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance135.0 ppm · rank 1076/3519 (69.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length480 aa
Molecular weight53.1 kDa
Theoretical pI6.17
GRAVY-0.27 (hydrophilic)
Aliphatic index92.3
Aromaticity0.058
Instability index39.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PolyA_polPF01743.27 4.6e-3339–165 Poly A polymerase head domain
PolyA_pol_RNAbdPF12627.13 6.3e-18193–252 Probable RNA and SrmB- binding site of polymerase A
HDPF01966.29 4.6e-15268–366 HD domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.8

PDB hitprobTM-scoreE-valueDescription
1miy-assembly1_B 1.00 0.70 7.1e-18 sig 1miy-assembly1_B Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with CTP
3wfs-assembly1_C 1.00 0.70 7.1e-17 sig 3wfs-assembly1_C tRNA processing enzyme complex 3
3wfo-assembly3_C 1.00 0.68 2.6e-17 sig 3wfo-assembly3_C tRNA processing enzyme (apo form 1)
3wfr-assembly1_E 1.00 0.69 6.0e-17 sig 3wfr-assembly1_E tRNA processing enzyme complex 2
6qxn-assembly1_A 1.00 0.69 2.7e-17 sig 6qxn-assembly1_A Crystal structure of the CCA-adding enzyme of a psychrophilic organism in complex with CTP

Foldseek search of the AlphaFold DB model (mean pLDDT 90.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv3906c (- strand, 24 bp gap)
Downstream (3' on genome)mutT4 (+ strand, 375 bp gap)
Predicted operon Rv3906c · pcnA

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) sigM (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mutT4 (mutator protein MutT), medium confidence from genomic context alone (score 689 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3906c hyp hypothetical protein 851 851 ctx neighborhood:849
Rv2773c dapB 4-hydroxy-tetrahydrodipicolinate reductase 779 779 coexpression:761
Rv3908 mutT4 mutator protein MutT 689 689 ctx neighborhood:679
Rv3909 hyp hypothetical protein 682 682 ctx neighborhood:679
Rv3910 murJ peptidoglycan biosynthesis protein 680 680 ctx neighborhood:679
Rv3219 whiB1 transcriptional regulator WhiB1 640 640 ctx cooccurence:640
Rv3905c esxF ESAT-6 like protein EsxF 588 589 ctx neighborhood:586
Rv3904c esxE ESAT-6 like protein EsxE 585 585 ctx neighborhood:582
Rv3903c cpnT hyp hypothetical protein 584 584 ctx neighborhood:583
Rv3902c ift hyp hypothetical protein 583 583 ctx neighborhood:582
Rv3441c mrsA phosphoglucosamine mutase 590 571 ctx fusion:552
Rv2783c gpsI exp bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 826 570 experimental:462 textmining:614
Rv3260c whiB2 transcriptional regulator WhiB2 556 556 ctx cooccurence:555
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 526 526 coexpression:511
Rv1547 dnaE1 DNA polymerase III subunit alpha 514 512 ctx cooccurence:496

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): poly(A) polymerase PcnA
  • Pfam (hmmscan --cut_ga): PolyA_pol PF01743.27 (E=5e-33), PolyA_pol_RNAbd PF12627.13 (E=6e-18), HD PF01966.29 (E=5e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178026.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PolyA_pol (PF01743.27), PolyA_pol_RNAbd (PF12627.13), HD (PF01966.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0617
  • Curated reference: UniProt L7N672 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor mutT4
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3907c|pcnA
MPEAVQEADLLTAAAVALNRHAALLRELGSVFAAAGHELYLVGGSVRDALLGRLSPDLDFTTDARPERVQEIVRPWADAVWDTGIEFGTVGVGKSDHRMEITTFRADSYDRVSRHPEVRFGDCLEGDLVRRDFTTNAMAVRVTATGPGEFLDPLGGLAALRAKVLDTPAAPSGSFGDDPLRMLRAARFVSQLGFAVAPRVRAAIEEMAPQLARISAERVAAELDKLLVGEDPAAGIDLMVQSGMGAVVLPEIGGMRMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDIGKPATRRHEPDGGVSFHHHEVVGAKMVRKRMRALKYSKQMIDDISQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGALLPRLHKLVRADCTTRNKRRAARLQASYDRLEERIAELAAQEDLDRVRPDLDGNQIMAVLDIPAGPQVGEAWRYLKELRLERGPLSTEEATTELLSWWKSRGNR