Rv1545 Still unknown · low auto-curated

H37Rv Rv1545 · MTBC0 mtbc0_001652 · 75 aa · 1756728–1756955 (+) · RefSeq NP_216061.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially boun (prob 0.03, TM 0.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLU9 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1545

UniProt still lists this protein as Uncharacterized protein Rv1545; the revised annotation above is ahead of the current UniProt record.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 41.0 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3cht-assembly1_B 0.03 0.23 5.4e+00 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially bound Ligand

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1544 (ketoacyl reductase), high confidence from genomic context alone (score 748 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1544 ketoacyl reductase 748 748 ctx neighborhood:739
Rv1543 oxidoreductase 745 745 ctx neighborhood:739
Rv1546 hyp hypothetical protein 860 655 ctx neighborhood:641 textmining:613
Rv1547 dnaE1 DNA polymerase III subunit alpha 491 490 ctx neighborhood:485
Rv1542c glbN hemoglobin GlbN 455 455 ctx neighborhood:455
Rv0059 darT hyp hypothetical protein 444 55 textmining:436
Rv0909 antitoxin 658 50 textmining:655
Rv0910 toxin 657 50 textmining:654
Rv3907c pcnA poly(A) polymerase PcnA 437 49 textmining:433
Rv2827c hyp hypothetical protein 529 47 textmining:527
Rv0060 darG hyp hypothetical protein 515 47 textmining:512
Rv2826c hyp hypothetical protein 516 46 textmining:514
Rv1989c mbcT hyp hypothetical protein 414 46 textmining:411
Rv1685c hyp hypothetical protein 803 44 textmining:803
Rv0837c hyp hypothetical protein 549 44 textmining:548

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially bound Ligand (prob 0.03, E=5e+00, TM=0.23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216061.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WLU9 (SwissProt, reviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 41.0, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv1544
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001652|Rv1545|
MPNGVLGLGNPSRLAALYGLQLAHESQCCQMHNLPSAARQVTVACREEVGITTILAGRDECGVCDKTAGLDGAAP