Rv1545 Still unknown · low auto-curated
H37Rv Rv1545 · MTBC0 mtbc0_001652 ·
75 aa · 1756728–1756955 (+) ·
RefSeq NP_216061.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially boun (prob 0.03, TM 0.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLU9
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv1545 |
UniProt still lists this protein as Uncharacterized protein Rv1545; the revised annotation above is ahead of the current UniProt record.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 41.0 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
3cht-assembly1_B |
0.03 | 0.23 | 5.4e+00 | 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially bound Ligand |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1544 (ketoacyl reductase), high confidence from genomic context alone (score 748 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1544 |
ketoacyl reductase | 748 | 748 ctx | neighborhood:739 |
Rv1543 |
oxidoreductase | 745 | 745 ctx | neighborhood:739 |
Rv1546 hyp |
hypothetical protein | 860 | 655 ctx | neighborhood:641 textmining:613 |
Rv1547 dnaE1 |
DNA polymerase III subunit alpha | 491 | 490 ctx | neighborhood:485 |
Rv1542c glbN |
hemoglobin GlbN | 455 | 455 ctx | neighborhood:455 |
Rv0059 darT hyp |
hypothetical protein | 444 | 55 | textmining:436 |
Rv0909 |
antitoxin | 658 | 50 | textmining:655 |
Rv0910 |
toxin | 657 | 50 | textmining:654 |
Rv3907c pcnA |
poly(A) polymerase PcnA | 437 | 49 | textmining:433 |
Rv2827c hyp |
hypothetical protein | 529 | 47 | textmining:527 |
Rv0060 darG hyp |
hypothetical protein | 515 | 47 | textmining:512 |
Rv2826c hyp |
hypothetical protein | 516 | 46 | textmining:514 |
Rv1989c mbcT hyp |
hypothetical protein | 414 | 46 | textmining:411 |
Rv1685c hyp |
hypothetical protein | 803 | 44 | textmining:803 |
Rv0837c hyp |
hypothetical protein | 549 | 44 | textmining:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 3cht-assembly1_B Crystal Structure of Di-iron AurF with partially bound Ligand (prob 0.03, E=5e+00, TM=0.23)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216061.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P9WLU9 (SwissProt, reviewed; Predicted)
- Model confidence: ESMFold per-residue pLDDT (mean 41.0, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv1544 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001652|Rv1545| MPNGVLGLGNPSRLAALYGLQLAHESQCCQMHNLPSAARQVTVACREEVGITTILAGRDECGVCDKTAGLDGAAP