tlyA Resolved · high auto-curated

H37Rv Rv1694 · MTBC0 mtbc0_001802 · 268 aa · 1929955–1930761 MTBC0 (+) · RefSeq NP_216210.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
MTBC0 PGAP re-annotation16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
Revised (this work)16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA. Pfam: S4 (PF01479.31), FtsJ (PF01728.26).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 82 publications

82 TB publications mention this gene. 82 publication(s) discuss this gene (77 in a M. tuberculosis context, 13 in other mycobacteria — M. smegmatis (9), M. leprae (6), M. marinum (2)).

Most recent 5 of 82.
PublicationDate
TlyA is a 23S and 16S 2'-O-methylcytidine methyltransferase important for ribosome assembly in Bacillus subtilis. doi:10.1093/nar/gkaf1531 2026
Microevolutionary models and multi-omics analysis uncover the cross-drug resistance characteristics of capreomycin-selected Mycobacterium tuberculosis. doi:10.1016/j.crmicr.2025.100507 2025
Drug selection based on pan-genomics genetic features of Mycobacterium tuberculosis. doi:10.3389/fmicb.2025.1663069 2025
Distant ribose 2'-O-methylation of 23S rRNA helix 69 pre-orders the capreomycin drug binding pocket at the ribosome subunit interface. doi:10.1093/nar/gkaf618 2025
TlyA is a 23S and 16S 2'-O-methylcytidine methyltransferase important for ribosome assembly in Bacillus subtilis. doi:10.1101/2025.04.21.649808 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbournadK (Rv1695, + strand)
Overlap1 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -3.13 (95% CI -9.11 to 3.94). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionMethylates 16S and 23S rRNA. Also has contact-dependent haemolytic activity; possibly involved in virulence (pore formation).

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1720 · 99.6% identity
M. leprae ML1358 · 78.7% identity
M. marinum MMAR_2499 · 81.3% identity
M. smegmatis MSMEG_3751 · 76.5% identity
M. orygis RJtmp_001771 · 99.6% identity
M. abscessus MAB_2359 · 69.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WJ63 SwissProt · reviewed · Evidence at protein level
UniProt name16S/23S rRNA
EC (curated) EC 2.1.1.226, EC 2.1.1.227
Curated functionActs as a host evasion factor, that significantly contributes to the pathogenesis of M.tuberculosis by modulating adaptive immune responses by inhibiting host-protective Th1 and Th17 cytokine responses as well as autophagy. Catalyzes the 2'-O-methylation at nucleotides C1409 in 16S rRNA and C1920 in 23S rRNA. Is likely involved in ribosomal biogenesis. Also exhibits hemolytic activity in vitro, by binding with and oligomerizing into host cell membranes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametlyA
eggNOG descriptionHemolysin TlyA
Orthologous groupCOG1189
EC number EC 2.1.1.226, EC 2.1.1.227
KEGG orthology K06442
Gene Ontology (65) GO:0000154, GO:0001510, GO:0001897, GO:0001906, GO:0001907, GO:0003674, GO:0003824, GO:0006139, GO:0006364, GO:0006396, GO:0006725, GO:0006807 +53 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.588 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 80.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 56.3%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 11 in the ORF — 1 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 0.727, mean read count 35.625. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Drug resistance (WHO catalogue) capreomycin

capreomycin342 catalogued resistance-associated variant(s)

This gene carries mutations classed Associated with resistance (WHO grade 1–2) in the consolidated catalogue (WHO 2nd ed. 2023 + tb-profiler). Only the R-associated tier is shown; "uncertain" and empirical-only signals are excluded. Test a specific strain or variant with the resistance tester. Research context, not a clinical diagnostic.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance3.88 ppm · rank 3023/3519 (14.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length268 aa
Molecular weight28.1 kDa
Theoretical pI9.74
GRAVY0.088 (hydrophobic)
Aliphatic index103.0
Aromaticity0.041
Instability index32.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
S4PF01479.31 3.1e-076–47 S4 domain
FtsJPF01728.26 1.4e-4562–244 FtsJ-like methyltransferase

Experimental structures (Protein Data Bank) 3 solved

PDBMethodResolutionCoverage
7s0s Electron Microscopy 3.05 Å 100%
5kyg X-ray diffraction 1.9 Å 78%
5ks2 X-ray diffraction 2.18 Å 78%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.5

PDB hitprobTM-scoreE-valueDescription
5eov-assembly1_A 1.00 0.99 2.6e-39 sig 5eov-assembly1_A C-terminal domain of the 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA.
7s0s-assembly1_B 1.00 0.79 5.0e-39 sig 7s0s-assembly1_B M. tuberculosis ribosomal RNA methyltransferase TlyA bound to M. smegmatis 50S ribosomal subunit
3hp7-assembly1_A 1.00 0.81 6.8e-28 sig 3hp7-assembly1_A Putative hemolysin from Streptococcus thermophilus.
3opn-assembly1_A 1.00 0.92 6.2e-23 sig 3opn-assembly1_A The crystal structure of a putative hemolysin from Lactococcus lactis
2fpo-assembly1_A 1.00 0.65 6.9e-08 sig 2fpo-assembly1_A Putative methyltransferase yhhF from Escherichia coli.

Foldseek search of the AlphaFold DB model (mean pLDDT 93.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 7

Upstream (5' on genome)Rv1693 (+ strand, 7 bp gap)
Downstream (3' on genome)ppnK (+ strand, -1 bp gap)
Predicted operon lprJ · Rv1691 · Rv1692 · Rv1693 · tlyA · ppnK · recN

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: ppnK (inorganic polyphosphate/ATP-NAD kinase), high confidence from genomic context alone (score 938 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 986 938 ctx neighborhood:882 coexpression:494 textmining:790
Rv1696 recN DNA repair protein RecN 917 895 ctx neighborhood:867
Rv1691 hyp hypothetical protein 946 886 ctx neighborhood:882 textmining:548
Rv1693 hyp hypothetical protein 945 883 ctx neighborhood:882 textmining:548
Rv1692 phosphatase 944 882 ctx neighborhood:882 textmining:548
Rv1697 steA hyp hypothetical protein 768 768 ctx neighborhood:766
Rv1698 mctB copper transporter MctB 750 750 ctx neighborhood:748
Rv1690 lprJ lipoprotein LprJ 732 733 ctx neighborhood:732
Rv1700 NUDIX hydrolase 657 657 ctx neighborhood:648
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 784 651 coexpression:647 textmining:407
Rv1701 xerD tyrosine recombinase XerD 646 646 ctx neighborhood:625
Rv1699 pyrG CTP synthase 670 629 ctx neighborhood:627
Rv2682c dxs1 1-deoxy-D-xylulose 5-phosphate synthase 469 469 coexpression:439
Rv3379c dxs2 1-deoxy-D-xylulose-5-phosphate synthase 455 455 coexpression:424
Rv1007c metS methionine--tRNA ligase 440 441 ctx cooccurence:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
  • MTBC0 PGAP product: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
  • Pfam (hmmscan --cut_ga): S4 PF01479.31 (E=3e-07), FtsJ PF01728.26 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216210.1)
  • Domains: Pfam-A via hmmscan --cut_ga — S4 (PF01479.31), FtsJ (PF01728.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1189
  • Curated reference: UniProt P9WJ63 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor ppnK
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Drug resistance: consolidated catalogue, WHO 2nd ed. 2023 (9789240082410) + tb-profiler; only the resistance-associated tier (grade 1–2) is surfaced
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001802|Rv1694|tlyA
MARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP