tlyA Resolved · high auto-curated

H37Rv Rv1694 · MTBC0 mtbc0_001802 · 268 aa · 1929955–1930761 (+) · RefSeq NP_216210.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
MTBC0 PGAP re-annotation16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
Revised (this work)16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA. Pfam: S4 (PF01479.31), FtsJ (PF01728.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ63 SwissProt · reviewed · Evidence at protein level
UniProt name16S/23S rRNA
EC (curated) EC 2.1.1.226, EC 2.1.1.227
Curated functionActs as a host evasion factor, that significantly contributes to the pathogenesis of M.tuberculosis by modulating adaptive immune responses by inhibiting host-protective Th1 and Th17 cytokine responses as well as autophagy. Catalyzes the 2'-O-methylation at nucleotides C1409 in 16S rRNA and C1920 in 23S rRNA. Is likely involved in ribosomal biogenesis. Also exhibits hemolytic activity in vitro, by binding with and oligomerizing into host cell membranes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametlyA
eggNOG descriptionHemolysin TlyA
Orthologous groupCOG1189
EC number EC 2.1.1.226, EC 2.1.1.227
KEGG orthology K06442
Gene Ontology (65) GO:0000154, GO:0001510, GO:0001897, GO:0001906, GO:0001907, GO:0003674, GO:0003824, GO:0006139, GO:0006364, GO:0006396, GO:0006725, GO:0006807 +53 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.588 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
S4PF01479.31 3.1e-076–47 S4 domain
FtsJPF01728.26 1.4e-4562–244 FtsJ-like methyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ppnK (inorganic polyphosphate/ATP-NAD kinase), high confidence from genomic context alone (score 938 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 986 938 ctx neighborhood:882 coexpression:494 textmining:790
Rv1696 recN DNA repair protein RecN 917 895 ctx neighborhood:867
Rv1691 hyp hypothetical protein 946 886 ctx neighborhood:882 textmining:548
Rv1693 hyp hypothetical protein 945 883 ctx neighborhood:882 textmining:548
Rv1692 phosphatase 944 882 ctx neighborhood:882 textmining:548
Rv1697 steA hyp hypothetical protein 768 768 ctx neighborhood:766
Rv1698 mctB copper transporter MctB 750 750 ctx neighborhood:748
Rv1690 lprJ lipoprotein LprJ 732 733 ctx neighborhood:732
Rv1700 NUDIX hydrolase 657 657 ctx neighborhood:648
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 784 651 coexpression:647 textmining:407
Rv1701 xerD tyrosine recombinase XerD 646 646 ctx neighborhood:625
Rv1699 pyrG CTP synthase 670 629 ctx neighborhood:627
Rv2682c dxs1 1-deoxy-D-xylulose 5-phosphate synthase 469 469 coexpression:439
Rv3379c dxs2 1-deoxy-D-xylulose-5-phosphate synthase 455 455 coexpression:424
Rv1007c metS methionine--tRNA ligase 440 441 ctx cooccurence:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
  • MTBC0 PGAP product: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
  • Pfam (hmmscan --cut_ga): S4 PF01479.31 (E=3e-07), FtsJ PF01728.26 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216210.1)
  • Domains: Pfam-A via hmmscan --cut_ga — S4 (PF01479.31), FtsJ (PF01728.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1189
  • Curated reference: UniProt P9WJ63 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor ppnK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001802|Rv1694|tlyA
MARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP