Rv0784 Still unknown · low auto-curated

H37Rv Rv0784 · MTBC0 - · 228 aa · 878638–879324 (+) · RefSeq NP_215298.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2334. Function unknown. Foldseek best (non-significant) hit: 3cqh-assembly1_A Crystal Structure of L-xylulose-5-phosphate 3-epimera (prob 0.21, TM 0.37).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P71837 TrEMBL · unreviewed · Predicted
UniProt nameDeacetylase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUncharacterized protein conserved in bacteria (DUF2334)
Orthologous groupCOG3233
KEGG orthology K06986

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2334PF10096.15 2.1e-209–133 Uncharacterized protein conserved in bacteria (DUF2334)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.4 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3cqh-assembly1_A 0.21 0.37 3.0e-01 3cqh-assembly1_A Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE from the Anaerobic L-ascorbate Utilization Pathway of Escherichia coli
5cew-assembly1_A 0.18 0.29 8.6e-02 5cew-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 2-(pyridin-4-yl)thiazolidine-4-carboxylic acid
6c8p-assembly1_A 0.15 0.26 9.7e-02 6c8p-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 2-F-phenyldiketoacid
3sad-assembly1_A 0.14 0.24 6.7e-02 3sad-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 4-(2-mehtylphenyl)-2,4-dioxobutanoic acid inhibitor
6as6-assembly1_A 0.14 0.24 4.7e-02 6as6-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 3-Prop-6-Me-phenyldiketoacid
5dri-assembly1_A 0.13 0.22 4.7e-02 5dri-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1H-indol-5-yl)-4-oxobut-2-enoic acid inhibitor
5ccz-assembly1_A 0.13 0.27 1.8e-01 5ccz-assembly1_A Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 3-(4-fluorophenyl)-4-methyl-1H-pyrazol-5-amine
1n8i-assembly1_A 0.12 0.27 1.7e-01 1n8i-assembly1_A Biochemical and Structural Studies of Malate Synthase from Mycobacterium tuberculosis

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0785 (KsdD-like steroid dehydrogenase), high confidence from genomic context alone (score 864 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0785 KsdD-like steroid dehydrogenase 863 864 ctx neighborhood:863
Rv0783c emrB multidrug resistance protein EmrB 761 761 ctx neighborhood:759
Rv0475 hbhA heparin binding hemagglutinin HbhA 704 705 ctx cooccurence:695
Rv3850 hyp hypothetical protein 700 701 ctx cooccurence:699
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 694 695 ctx cooccurence:691
Rv0556 transmembrane protein 693 694 ctx cooccurence:693
Rv2342 hyp hypothetical protein 677 677 ctx cooccurence:673
Rv0358 hyp hypothetical protein 653 653 ctx cooccurence:650
Rv0996 transmembrane protein 649 649 ctx cooccurence:646
Rv1081c membrane protein 649 649 ctx cooccurence:647
Rv2138 lppL lipoprotein LppL 645 646 ctx cooccurence:644
Rv3438 hyp hypothetical protein 633 633 ctx cooccurence:633
Rv2732c transmembrane protein 629 630 ctx cooccurence:626
Rv2525c hyp hypothetical protein 619 619 ctx cooccurence:615
Rv3205c hyp hypothetical protein 614 614 ctx cooccurence:609

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF2334 PF10096.15 (E=2e-20)
  • Foldseek best: 3cqh-assembly1_A Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE fr (prob 0.21, E=3e-01, TM=0.37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215298.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2334 (PF10096.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3233
  • Curated reference: UniProt P71837 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.4, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor Rv0785
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0784|
MSVSGIGESTLADVDAFCAEMDARSVPVSLLVAPRMRDDYRLDRDPRTVDWLTGRRAAGDALVLHGYDEAATKRRRGEFAMLRAHEANLRLMAADRVLEHLGLRTRLFAAPGWLVSPGVRTALPANGFRLLADLHGITDLVRLTTVRARVLGIGEGFLAEPWWCRMVVMSAERIARRGGVVRIAVAARHLRKSGPLQAMLDAVDLAMLQGCTPMVYRWRADAAVLDAA