Rv1587c Still unknown · low auto-curated

H37Rv Rv1587c · MTBC0 - · 333 aa · 1788162–1789163 (-) · RefSeq NP_216103.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF222. Function unknown. Foldseek best (non-significant) hit: 4h9d-assembly1_B Crystal Structure of Mn-dependent Gme HNH nicking end (prob 0.23, TM 0.72).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06603 TrEMBL · unreviewed · Predicted
UniProt namePartial REP13E12 repeat protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionDomain of unknown function (DUF222)
Orthologous groupCOG1403

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.847 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (192) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF222PF02720.23 5.7e-402–145 Domain of unknown function (DUF222)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 67.8 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4h9d-assembly1_B 0.23 0.72 2.8e+00 4h9d-assembly1_B Crystal Structure of Mn-dependent Gme HNH nicking endonuclease from Geobacter metallireducens GS-15, Northeast Structural Genomics Consortium (NESG) Target GmR87
7mpz-assembly1_A 0.21 0.42 4.8e-01 7mpz-assembly1_A HNH Nuclease Domain from G. stearothermophilus Cas9
4h9d-assembly1_C 0.16 0.77 6.0e+00 4h9d-assembly1_C Crystal Structure of Mn-dependent Gme HNH nicking endonuclease from Geobacter metallireducens GS-15, Northeast Structural Genomics Consortium (NESG) Target GmR87
5zmm-assembly1_E 0.14 0.46 1.8e+00 5zmm-assembly1_E Structure of the Type IV phosphorothioation-dependent restriction endonuclease ScoMcrA
5zmm-assembly1_F 0.12 0.42 1.8e+00 5zmm-assembly1_F Structure of the Type IV phosphorothioation-dependent restriction endonuclease ScoMcrA
5zmm-assembly1_B 0.12 0.43 2.0e+00 5zmm-assembly1_B Structure of the Type IV phosphorothioation-dependent restriction endonuclease ScoMcrA
5zmm-assembly1_C 0.11 0.39 1.8e+00 5zmm-assembly1_C Structure of the Type IV phosphorothioation-dependent restriction endonuclease ScoMcrA
5zmm-assembly1_D 0.09 0.40 2.6e+00 5zmm-assembly1_D Structure of the Type IV phosphorothioation-dependent restriction endonuclease ScoMcrA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1586c (phage integrase), high confidence from genomic context alone (score 882 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1586c phage integrase 882 882 ctx neighborhood:780
Rv3467 hyp hypothetical protein 809 809 coexpression:806
Rv1585c phage protein 788 788 ctx neighborhood:773
Rv1588c hyp hypothetical protein 787 787 ctx neighborhood:773
Rv0393 hyp hypothetical protein 745 746 ctx cooccurence:742
Rv0515 hyp hypothetical protein 726 727 ctx cooccurence:720
Rv0336 hyp hypothetical protein 726 726 ctx cooccurence:719
Rv3776 hyp hypothetical protein 716 717 ctx cooccurence:703
Rv2100 hyp hypothetical protein 703 704 ctx cooccurence:695
Rv1765c hyp hypothetical protein 681 681 ctx cooccurence:677
Rv2015c hyp hypothetical protein 645 645 ctx cooccurence:642
Rv1582c phage protein 630 627 ctx neighborhood:617
Rv1584c phage protein 616 616 ctx neighborhood:605
Rv1583c phage protein 608 607 ctx neighborhood:605
Rv1378c hyp hypothetical protein 591 591 ctx cooccurence:584

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF222 PF02720.23 (E=6e-40)
  • Foldseek best: 4h9d-assembly1_B Crystal Structure of Mn-dependent Gme HNH nicking endonuclease (prob 0.23, E=3e+00, TM=0.72)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216103.2)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF222 (PF02720.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1403
  • Curated reference: UniProt O06603 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 67.8, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv1586c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1587c|
MLAKLAAPGATNPDDHTPVIDTTPDAAAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDLQTGAGKGFTGGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFANDRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACGPDNRLAEKGWTTHNNTHGHTEWLPPPHLDHGQPWTCEIHYTCACCCLPPNLRRPLRRTARRGPPTRGLPKAVRAAKMGARRVPRQRRQRINRQAPPRLRADVGRHHRRQDRRRGGLGPGPAPSPSHRAGSLHVISRREAAGPGHRRRRR