xseB Family assigned · medium auto-curated

H37Rv Rv1107c · MTBC0 mtbc0_001189 · 85 aa · 1242406–1242663 (-) · RefSeq NP_215623.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)exodeoxyribonuclease VII small subunit
MTBC0 PGAP re-annotationexodeoxyribonuclease VII small subunit
Revised (this work)Exodeoxyribonuclease VII small subunit. Pfam: Exonuc_VII_S (PF02609.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF29 SwissProt · reviewed · Evidence at protein level
UniProt nameExodeoxyribonuclease 7 small subunit
EC (curated) EC 3.1.11.6
Curated functionBidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namexseB
eggNOG descriptionBidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides
Orthologous groupCOG1722
EC number EC 3.1.11.6
KEGG orthology K03602
KEGG pathways map03430

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Exonuc_VII_SPF02609.22 2.9e-1624–74 Exonuclease VII small subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: xseA (exodeoxyribonuclease VII large subunit), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1108c xseA exodeoxyribonuclease VII large subunit 999 999 ctx neighborhood:882 coexpression:890 experimental:474 database:900 textmining:622
Rv1109c hyp hypothetical protein 886 886 ctx neighborhood:882
Rv1106c 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase 888 884 ctx neighborhood:882
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 808 788 ctx neighborhood:782
Rv0510 hemC porphobilinogen deaminase 678 678 coexpression:678
Rv2050 rbpA RNA polymerase-binding protein RbpA 637 637 ctx cooccurence:636
Rv2699c hyp hypothetical protein 587 587 ctx cooccurence:587
Rv3195 hyp hypothetical protein 576 577 ctx cooccurence:574
Rv0807 hyp hypothetical protein 569 569 ctx cooccurence:565
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 669 568 ctx cooccurence:530
Rv1830 HTH-type transcriptional regulator 567 567 ctx cooccurence:557
Rv2588c yajC membrane protein secretion factor YajC 572 531 coexpression:443
Rv1423 whiA transcriptional regulator WhiA 529 529 ctx cooccurence:525
Rv1540 RNA pseudouridine synthase 542 523 coexpression:414
Rv2173 idsA2 geranylgeranyl pyrophosphate synthetase IdsA 552 516 coexpression:417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: exodeoxyribonuclease VII small subunit
  • MTBC0 PGAP product: exodeoxyribonuclease VII small subunit
  • Pfam (hmmscan --cut_ga): Exonuc_VII_S PF02609.22 (E=3e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215623.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Exonuc_VII_S (PF02609.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1722
  • Curated reference: UniProt P9WF29 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor xseA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001189|Rv1107c|xseB
MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVSDVLAGDEAQNG