sigI Resolved · high auto-curated

H37Rv Rv1189 · MTBC0 mtbc0_001277 · 290 aa · 1340534–1341406 (+) · RefSeq NP_215705.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ECF RNA polymerase sigma factor SigI
MTBC0 PGAP re-annotationRNA polymerase sigma factor SigI
Revised (this work)RNA polymerase sigma factor SigI. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGH3 SwissProt · reviewed · Evidence at transcript level
UniProt nameProbable ECF RNA polymerase sigma factor SigI
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor until released, although no anti-sigma factor is known for this protein (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigI
eggNOG descriptionBelongs to the sigma-70 factor family. ECF subfamily
Orthologous groupCOG1595
KEGG orthology K03088

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.593 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.53% of strains (2225) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 1.0e-0812–74 Sigma-70 region 2
Sigma70_r4_2PF08281.19 1.8e-11111–162 Sigma-70, region 4

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1931c (transcriptional regulator), high confidence from genomic context alone (score 905 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1190 hyp hypothetical protein 971 972 ctx neighborhood:741 coexpression:860
Rv1931c transcriptional regulator 908 905 ctx cooccurence:489 coexpression:822
Rv1725c hyp hypothetical protein 871 872 coexpression:833
Rv3167c TetR family transcriptional regulator 868 868 coexpression:834
Rv1675c cmr HTH-type transcriptional regulator Cmr 870 865 coexpression:845
Rv2488c LuxR family transcriptional regulator 868 860 coexpression:829
Rv3082c virS HTH-type transcriptional regulator VirS 844 838 coexpression:804
Rv3736 AraC/XylS family transcriptional regulator 842 836 coexpression:806
Rv0894 transcriptional regulator 833 833 coexpression:791
Rv3124 moaR1 transcriptional regulator MoaR 833 833 coexpression:833
Rv3055 TetR family transcriptional regulator 832 832 coexpression:803
Rv3840 transcriptional regulator 831 832 coexpression:831
Rv0887c hyp hypothetical protein 831 831 ctx cooccurence:431 coexpression:716
Rv1556 HTH-type transcriptional regulator 828 829 coexpression:797
Rv1460 sufR transcriptional regulator 825 826 coexpression:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigI
  • MTBC0 PGAP product: RNA polymerase sigma factor SigI
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=1e-08), Sigma70_r4_2 PF08281.19 (E=2e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215705.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1595
  • Curated reference: UniProt P9WGH3 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 97 functional partner(s); context anchor Rv1931c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001277|Rv1189|sigI
MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLGPAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG