sigI Resolved · high auto-curated

H37Rv Rv1189 · MTBC0 mtbc0_001277 · 290 aa · 1340534–1341406 MTBC0 (+) · RefSeq NP_215705.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ECF RNA polymerase sigma factor SigI
MTBC0 PGAP re-annotationRNA polymerase sigma factor SigI
Revised (this work)RNA polymerase sigma factor SigI. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 10 publications

10 TB publications mention this gene. 10 publication(s) discuss this gene (9 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).

Most recent 5 of 10.
PublicationDate
Divergent transcriptional regulation of redox-homeostasis and permeability modulate rifampicin tolerance and sensitivity in Mycobacterium tuberculosis. doi:10.1038/s41467-025-67152-2 2025
Strain identification of Mycobacterium tuberculosis in multidrug-resistant tuberculosis (MDR-TB) patients at Undata Hospital, Palu, Central Sulawesi. doi:10.1016/j.ijtb.2023.04.003 2024
Mycobacterial DNA-binding protein 1 is critical for BCG survival in stressful environments and simultaneously regulates gene expression. doi:10.1038/s41598-023-40941-9 2023
Distribution of sigma factors delineates segregation of virulent and avirulent Mycobacterium. doi:10.1007/s00203-020-02172-8 2021
The C-terminal domain of M. tuberculosis ECF sigma factor I (SigI) interferes in SigI-RNAP interaction. doi:10.1007/s00894-020-4322-y 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Unc_7.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.00 (95% CI -1.67 to 4.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1221 · 100.0% identity
M. marinum MMAR_4487 · 31.3% identity
M. orygis RJtmp_001255 · 100.0% identity
M. abscessus MAB_2999c · 47.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WGH3 SwissProt · reviewed · Evidence at transcript level
UniProt nameProbable ECF RNA polymerase sigma factor SigI
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor until released, although no anti-sigma factor is known for this protein (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigI
eggNOG descriptionBelongs to the sigma-70 factor family. ECF subfamily
Orthologous groupCOG1595
KEGG orthology K03088

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.593 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.53% of strains (2225) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.119 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 43.4% · 3/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 37.2%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 40.25. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance0.72 ppm · rank 3318/3519 (5.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length290 aa
Molecular weight31.4 kDa
Theoretical pI6.06
GRAVY0.09 (hydrophobic)
Aliphatic index108.6
Aromaticity0.041
Instability index40.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 1.0e-0812–74 Sigma-70 region 2
Sigma70_r4_2PF08281.19 1.8e-11111–162 Sigma-70, region 4

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 77.3

PDB hitprobTM-scoreE-valueDescription
5xe7-assembly1_A 1.00 0.50 5.2e-12 sig 5xe7-assembly1_A Crystal structure of Mycobacterium tuberculosis extracytoplasmic function sigma factor SigJ
7qh5-assembly2_B 1.00 0.51 3.8e-11 sig 7qh5-assembly2_B The crystal structure of the sigma factor SigG1 from Streptomyces tsukubaensis NRRL18488
5xe7-assembly2_B 1.00 0.49 5.2e-12 sig 5xe7-assembly2_B Crystal structure of Mycobacterium tuberculosis extracytoplasmic function sigma factor SigJ
5wuq-assembly1_A 1.00 0.69 6.3e-04 sig 5wuq-assembly1_A Crystal structure of SigW in complex with its anti-sigma RsiW, a zinc binding form
5wur-assembly1_A 1.00 0.70 8.0e-04 sig 5wur-assembly1_A Crystal structure of SigW in complex with its anti-sigma RsiW, an oxdized form

Foldseek search of the AlphaFold DB model (mean pLDDT 77.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv1188 (+ strand, 81 bp gap)
Downstream (3' on genome)Rv1190 (+ strand, 15 bp gap)
Predicted operon sigI · Rv1190

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (1 TF) Rv0081 (activates)
Regulonthis transcription factor regulates 19 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv1931c (transcriptional regulator), high confidence from genomic context alone (score 905 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1190 hyp hypothetical protein 971 972 ctx neighborhood:741 coexpression:860
Rv1931c transcriptional regulator 908 905 ctx cooccurence:489 coexpression:822
Rv1725c hyp hypothetical protein 871 872 coexpression:833
Rv3167c TetR family transcriptional regulator 868 868 coexpression:834
Rv1675c cmr HTH-type transcriptional regulator Cmr 870 865 coexpression:845
Rv2488c LuxR family transcriptional regulator 868 860 coexpression:829
Rv3082c virS HTH-type transcriptional regulator VirS 844 838 coexpression:804
Rv3736 AraC/XylS family transcriptional regulator 842 836 coexpression:806
Rv0894 transcriptional regulator 833 833 coexpression:791
Rv3124 moaR1 transcriptional regulator MoaR 833 833 coexpression:833
Rv3055 TetR family transcriptional regulator 832 832 coexpression:803
Rv3840 transcriptional regulator 831 832 coexpression:831
Rv0887c hyp hypothetical protein 831 831 ctx cooccurence:431 coexpression:716
Rv1556 HTH-type transcriptional regulator 828 829 coexpression:797
Rv1460 sufR transcriptional regulator 825 826 coexpression:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigI
  • MTBC0 PGAP product: RNA polymerase sigma factor SigI
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=1e-08), Sigma70_r4_2 PF08281.19 (E=2e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215705.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1595
  • Curated reference: UniProt P9WGH3 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 77.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 97 functional partner(s); context anchor Rv1931c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001277|Rv1189|sigI
MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLGPAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG