vapB12 Resolved · high auto-curated

H37Rv Rv1721c · MTBC0 mtbc0_001833 · 75 aa · 1959431–1959658 (-) · RefSeq NP_216237.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB12
MTBC0 PGAP re-annotationantitoxin
Revised (this work)Antitoxin. Pfam: FitA-like_RHH (PF22513.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ53 SwissProt · reviewed · Evidence at protein level
UniProt namePutative antitoxin VapB12
Curated functionPutative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC12.

UniProt still lists this protein as Putative antitoxin VapB12; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DG55

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FitA-like_RHHPF22513.3 3.6e-073–39 Antitoxin FitA-like, ribbon-helix-helix

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC12 (ribonuclease VapC12), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1720c vapC12 ribonuclease VapC12 944 884 ctx neighborhood:882 textmining:540
Rv1722 carboxylase 515 515 ctx neighborhood:512
Rv1723 hydrolase 512 512 ctx neighborhood:512
Rv2871 vapB43 antitoxin VapB43 441 50 textmining:436
Rv1585c phage protein 543 47 textmining:541
Rv0662c vapB7 antitoxin VapB7 522 47 textmining:519
Rv1802 PPE30 PPE family protein PPE30 431 46 textmining:429
Rv1584c phage protein 513 45 textmining:511
Rv0370c oxidoreductase 550 44 textmining:549
Rv2250A Possible flavoprotein; Rv2250A, len: 139 aa. Conserved hypothetical protein, possibly flavoprotein. Similar to N-terminus of SCF91.28c|AL132 550 44 textmining:549
Rv2601A vapB41 antitoxin VapB41 511 44 textmining:510
Rv1960c parD1 antitoxin ParD1 433 44 textmining:432
Rv3167c TetR family transcriptional regulator 432 44 textmining:431
Rv0665 vapC8 ribonuclease VapC8 422 44 textmining:421
Rv2251 flavoprotein 549 42 textmining:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB12
  • MTBC0 PGAP product: antitoxin
  • Pfam (hmmscan --cut_ga): FitA-like_RHH PF22513.3 (E=4e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216237.2)
  • Domains: Pfam-A via hmmscan --cut_ga — FitA-like_RHH (PF22513.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DG55
  • Curated reference: UniProt P9WJ53 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor vapC12
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001833|Rv1721c|vapB12
MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLGASAAELVDEARSE