Rv0071 Family assigned · medium auto-curated

H37Rv Rv0071 · MTBC0 mtbc0_000078 · 241 aa · 79631–80356 (+) · RefSeq NP_214585.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)maturase
MTBC0 PGAP re-annotationreverse transcriptase domain-containing protein
Revised (this work)Reverse transcriptase domain-containing protein. Pfam: RVT_1 (PF00078.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53616 TrEMBL · unreviewed · Predicted
UniProt namePossible maturase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionReverse transcriptase (RNA-dependent DNA polymerase)
Orthologous groupCOG3344
EC number EC 2.7.7.49
KEGG orthology K00986

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.678 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RVT_1PF00078.33 2.1e-1577–192 Reverse transcriptase (RNA-dependent DNA polymerase)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3428c (transposase), medium confidence from genomic context alone (score 670 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2816c cas2 CRISPR-associated endoribonuclease Cas2 819 806 experimental:790
Rv3428c transposase 670 670 ctx cooccurence:657
Rv2424c transposase 649 649 ctx cooccurence:639
Rv2177c transposase 623 623 ctx cooccurence:614
Rv3427c istB transposase 590 587 ctx cooccurence:585
Rv2944 insertion sequence element IS1533 transposase 445 440 ctx cooccurence:436
Rv1034c Probable transposase (fragment); Rv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E12023 423 423 ctx cooccurence:413
Rv3387 transposase 423 423 ctx cooccurence:413
Rv1366 hyp hypothetical protein 416 417 coexpression:417
Rv3638 transposase 413 408 ctx cooccurence:400
Rv3386 transposase 404 405
Rv2515c hyp hypothetical protein 440 250
Rv2979c resolvase 425 199
Rv0605 IS1536 family serine type transposase 420 193
Rv0921 resolvase 419 190

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: maturase
  • MTBC0 PGAP product: reverse transcriptase domain-containing protein
  • Pfam (hmmscan --cut_ga): RVT_1 PF00078.33 (E=2e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214585.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RVT_1 (PF00078.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3344
  • Curated reference: UniProt O53616 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor Rv3428c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000078|Rv0071|
MSSITVSVDPVDPVDPVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGALEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPIFETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRHRIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRYRGNTIPTPWTQAV