vapC4 Resolved · high auto-curated

H37Rv Rv0595c · MTBC0 mtbc0_000625 · 130 aa · 698391–698783 (-) · RefSeq NP_215109.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC4
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin ribonuclease C4
Revised (this work)Type II toxin-antitoxin system toxin ribonuclease C4. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07783 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC4
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Probably exerts its toxic effect by binding to mRNA, inhibiting translation. Binds to, recognizes and cleaves ssRNA at ACGC and AC(A/U)GC sequences, usually between the G and C; cleavage is not very efficient, nor is cleavage required to inhibit protein synthesis. Upon expression in situ, in M.smegmatis or E.coli inhibits cell growth and colony formation; in at least E.coli also causes increased levels of cellular RNA. Its toxic effect is neutralized by coexpression with cognate antitoxin VapB4.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1487
Gene Ontology (8) GO:0005575, GO:0005576, GO:0008150, GO:0040008, GO:0045926, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.439 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (500) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 4.7e-177–123 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB5 (antitoxin VapB5), high confidence from genomic context alone (score 977 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0626 vapB5 antitoxin VapB5 977 977 ctx cooccurence:771 experimental:891
Rv0596c vapB4 antitoxin VapB4 985 956 ctx neighborhood:801 experimental:784 textmining:672
Rv0749 vapC31 ribonuclease VapC31 807 558 ctx cooccurence:550 textmining:581
Rv0597c hyp hypothetical protein 555 555 ctx neighborhood:473
Rv3479 transmembrane protein 529 529 ctx cooccurence:529
Rv3697c vapC48 ribonuclease VapC48 527 528 ctx cooccurence:523
Rv2872 vapC43 ribonuclease VapC43 760 527 ctx cooccurence:517 textmining:514
Rv0277c vapC25 ribonuclease VapC25 879 518 ctx cooccurence:509 textmining:761
Rv3407 vapB47 antitoxin VapB47 503 503
Rv2103c vapC37 ribonuclease VapC37 754 498 ctx cooccurence:493 textmining:531
Rv1242 vapC33 ribonuclease VapC33 815 493 ctx cooccurence:488 textmining:651
Rv0659c mazF2 toxin MazF2 476 475 ctx cooccurence:470
Rv3408 vapC47 ribonuclease VapC47 698 465 ctx cooccurence:457 textmining:459
Rv3180c vapC49 ribonuclease VapC45 675 451 ctx cooccurence:445 textmining:434
Rv1720c vapC12 ribonuclease VapC12 459 447 ctx cooccurence:442

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC4
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin ribonuclease C4
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=5e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215109.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1487
  • Curated reference: UniProt O07783 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor vapB5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000625|Rv0595c|vapC4
MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI