lpqX Still unknown · low auto-curated

H37Rv Rv1228 · MTBC0 mtbc0_001316 · 185 aa · 1379364–1379921 MTBC0 (+) · RefSeq NP_215744.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1215c (Rv1215c) — family_assigned: CocE/NonD family hydrolase Rv1216c (Rv1216c) — family_assigned: isoprenylcysteine carboxylmethyltransferase family protein Rv1217c (Rv1217c) — family_assigned: multidrug efflux ABC transporter permease Rv1217c Rv1218c (Rv1218c) — family_assigned: multidrug efflux ABC transporter ATP-binding protein Rv1218c raaS (Rv1219c) — family_assigned: transcriptional regulator RaaS sigE (Rv1221) — requalified: RNA polymerase sigma factor SigE rseA (Rv1222) — requalified: anti-sigma E factor RseA tatB (Rv1224) — requalified: Sec-independent protein translocase protein TatB Rv1225c (Rv1225c) — family_assigned: HAD-IIA family hydrolase Rv1225c Rv1226c (Rv1226c) — family_assigned: PH domain-containing protein Rv1226c Rv1227c (Rv1227c) — family_assigned: PH domain-containing protein lpqX (Rv1228) — dark: hypothetical protein mrp (Rv1229c) — family_assigned: Mrp/NBP35 family ATP-binding protein mrp Rv1230c (Rv1230c) — family_assigned: lytic transglycosylase domain-containing protein Rv1230c Rv1231c (Rv1231c) — family_assigned: DUF1003 domain-containing protein Rv1232c (Rv1232c) — requalified: magnesium transporter Rv1232c Rv1233c (Rv1233c) — family_assigned: DUF4190 domain-containing protein Rv1234 (Rv1234) — requalified: general stress protein lpqY (Rv1235) — family_assigned: trehalose ABC transporter substrate-binding protein LpqY lpqY sugA (Rv1236) — family_assigned: trehalose ABC transporter permease SugA sugA sugB (Rv1237) — family_assigned: trehalose ABC transporter permease SugB sugB sugC (Rv1238) — family_assigned: trehalose ABC transporter ATP-binding protein SugC sugC corA (Rv1239c) — requalified: magnesium/cobalt transporter CorA corA 1 368 kb 1 372 kb 1 376 kb 1 380 kb 1 384 kb 1 388 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqX
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No TB publication mentions this locus tag in its title or abstract (sweep of a ~330k-abstract PubMed TB corpus). This gene is genuinely unstudied: its darkness reflects absence of investigation, not failure of investigation.

An antigen status or a virulence phenotype is NOT a molecular function: the verdict stays unchanged. This layer adds the missing context, it does not requalify the gene. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep of title+abstract: the H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder17% of residues (metapredict) · mean AlphaFold pLDDT 59.5
Disordered regions1 IDR(s), longest 32 aa [0-32]

carries a substantial disordered region (32/185 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 0.89 (95% CI -1.50 to 3.87). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1260 · 100.0% identity
M. orygis RJtmp_001293 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O33224 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable lipoprotein LpqX

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 1/53 (2%) · mean identity 80.3% · 1/4 closest MTBAP relatives
present in a subset of the genus (1/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 9 in the ORF — 0 in the essential state, 0 growth-defect, 1 non-essential, 8 growth-advantage. Saturation 1.000, mean read count 207.777777778. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance10.5 ppm · rank 2660/3519 (24.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length185 aa
Molecular weight19.5 kDa
Theoretical pI5.67
GRAVY-0.093 (hydrophilic)
Aliphatic index77.6
Aromaticity0.065
Instability index36.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv1227c (- strand, 94 bp gap)
Downstream (3' on genome)Rv1228a (+ strand, 51 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv1227c (transmembrane protein), medium confidence from genomic context alone (score 550 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1227c transmembrane protein 549 550 ctx neighborhood:547
Rv1226c transmembrane protein 549 549 ctx neighborhood:547
Rv2403c lppR lipoprotein LppR 655 46 textmining:654
Rv2138 lppL lipoprotein LppL 545 46 textmining:543
Rv0399c lpqK lipoprotein LpqK 655 45 textmining:654
Rv0419 lpqM lipoprotein peptidase LpqM 615 44 textmining:614
Rv3576 lppH lipoprotein LppH 517 44 textmining:516
Rv3044 fecB FeIII-dicitrate-binding periplasmic lipoprotein 440 44 textmining:439
Rv0237 lpqI lipoprotein LpqI 630 42 textmining:630
Rv1857 modA molybdate ABC transporter substrate-binding lipoprotein ModA 514 42 textmining:514
Rv3244c lpqB lipoprotein LpqB 630 41 textmining:630
Rv1016c lpqT lipoprotein LpqT 542 41 textmining:542
Rv0418 lpqL lipoprotein aminopeptidase LpqL 475 41 textmining:475
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 433 41 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqX
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215744.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O33224 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv1227c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001316|Rv1228|lpqX
MSRQWHWLAATLLLITTAACSRPGTEEPDCPTKITLPPGATPTTTLDPRCIVRATTTGTADGDAASRWTGTVRIAGFYASICNAVWDGNVSLAGKDELTGKATLILVETSCPGKVVAGELVLKGNVGSDSLAITWAHPELPQRAFDLGAGQGTIRRSGDRAEGTFNSDMGGGTEFFLTWSLTMRN