sugB Family assigned · medium auto-curated

H37Rv Rv1237 · MTBC0 mtbc0_001326 · 274 aa · 1388299–1389123 (+) · RefSeq NP_215753.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar ABC transporter permease SugB
MTBC0 PGAP re-annotationtrehalose ABC transporter permease SugB
Revised (this work)Trehalose ABC transporter permease SugB. Pfam: BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG01 SwissProt · reviewed · Evidence at protein level
UniProt nameTrehalose transport system permease protein SugB
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Probably responsible for the translocation of the substrate across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namesugB
eggNOG descriptioninner membrane component
Orthologous groupCOG0395
KEGG orthology K02026
KEGG modules M00207
Gene Ontology (8) GO:0008150, GO:0040007, GO:0044110, GO:0044116, GO:0044117, GO:0044403, GO:0044419, GO:0051704

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.123 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1PF00528.28 6.5e-2180–266 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sugA (sugar ABC transporter permease SugA), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1236 sugA sugar ABC transporter permease SugA 999 1000 ctx neighborhood:882 cooccurence:774 coexpression:557 experimental:932 database:900 textmining:977
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 999 1000 ctx neighborhood:881 cooccurence:771 coexpression:463 experimental:997 database:900 textmining:900
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 999 1000 ctx neighborhood:881 cooccurence:771 coexpression:451 experimental:997 textmining:902
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 982 979 ctx cooccurence:741 coexpression:440 experimental:858
Rv2038c ugpC sugar ABC transporter ATP-binding protein 981 979 ctx cooccurence:739 coexpression:441 experimental:858
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 976 961 coexpression:446 experimental:914 textmining:424
Rv2041c sugar ABC transporter substrate-binding lipoprotein 959 943 ctx cooccurence:404 coexpression:449 experimental:828
Rv2040c sugar ABC transporter permease 949 925 ctx cooccurence:765 coexpression:486 experimental:412
Rv2316 uspA sugar ABC transporter permease UspA 954 923 ctx cooccurence:760 coexpression:480 experimental:412 textmining:438
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 953 909 ctx cooccurence:716 coexpression:480 experimental:412 textmining:517
Rv1234 transmembrane protein 846 846 ctx neighborhood:844
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 825 673 coexpression:449 experimental:412 textmining:487
Rv1233c hyp hypothetical protein 504 505 ctx neighborhood:502
Rv1231c membrane protein 426 425 ctx neighborhood:420
Rv3604c transmembrane protein 443 422 coexpression:402

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar ABC transporter permease SugB
  • MTBC0 PGAP product: trehalose ABC transporter permease SugB
  • Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=6e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215753.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0395
  • Curated reference: UniProt P9WG01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor sugA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001326|Rv1237|sugB
MGARRATYWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERAIGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG