sugB Family assigned · medium auto-curated
H37Rv Rv1237 · MTBC0 mtbc0_001326 ·
274 aa · 1388299–1389123 (+) ·
RefSeq NP_215753.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sugar ABC transporter permease SugB |
|---|---|
| MTBC0 PGAP re-annotation | trehalose ABC transporter permease SugB |
| Revised (this work) | Trehalose ABC transporter permease SugB. Pfam: BPD_transp_1 (PF00528.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WG01
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Trehalose transport system permease protein SugB |
| Curated function | Part of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Probably responsible for the translocation of the substrate across the membrane. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | sugB |
| eggNOG description | inner membrane component |
| Orthologous group | COG0395 |
| KEGG orthology |
K02026
|
| KEGG modules |
M00207
|
| Gene Ontology (8) |
GO:0008150, GO:0040007, GO:0044110, GO:0044116, GO:0044117, GO:0044403, GO:0044419, GO:0051704
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.123 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BPD_transp_1 | PF00528.28 | 6.5e-21 | 80–266 | Binding-protein-dependent transport system inner membrane component |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sugA (sugar ABC transporter permease SugA), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1236 sugA |
sugar ABC transporter permease SugA | 999 | 1000 ctx | neighborhood:882 cooccurence:774 coexpression:557 experimental:932 database:900 textmining:977 |
Rv1238 sugC |
sugar ABC transporter ATP-binding protein SugC | 999 | 1000 ctx | neighborhood:881 cooccurence:771 coexpression:463 experimental:997 database:900 textmining:900 |
Rv1235 lpqY |
trehalose ABC transporter substrate-binding lipoprotein LpqY | 999 | 1000 ctx | neighborhood:881 cooccurence:771 coexpression:451 experimental:997 textmining:902 |
Rv2832c ugpC |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | 982 | 979 ctx | cooccurence:741 coexpression:440 experimental:858 |
Rv2038c ugpC |
sugar ABC transporter ATP-binding protein | 981 | 979 ctx | cooccurence:739 coexpression:441 experimental:858 |
Rv2833c ugpB |
sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB | 976 | 961 | coexpression:446 experimental:914 textmining:424 |
Rv2041c |
sugar ABC transporter substrate-binding lipoprotein | 959 | 943 ctx | cooccurence:404 coexpression:449 experimental:828 |
Rv2040c |
sugar ABC transporter permease | 949 | 925 ctx | cooccurence:765 coexpression:486 experimental:412 |
Rv2316 uspA |
sugar ABC transporter permease UspA | 954 | 923 ctx | cooccurence:760 coexpression:480 experimental:412 textmining:438 |
Rv2835c ugpA |
sn-glycerol-3-phosphate ABC transporter permease UgpA | 953 | 909 ctx | cooccurence:716 coexpression:480 experimental:412 textmining:517 |
Rv1234 |
transmembrane protein | 846 | 846 ctx | neighborhood:844 |
Rv2318 uspC |
sugar ABC transporter substrate-binding lipoprotein UspC | 825 | 673 | coexpression:449 experimental:412 textmining:487 |
Rv1233c hyp |
hypothetical protein | 504 | 505 ctx | neighborhood:502 |
Rv1231c |
membrane protein | 426 | 425 ctx | neighborhood:420 |
Rv3604c |
transmembrane protein | 443 | 422 | coexpression:402 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sugar ABC transporter permease SugB
- MTBC0 PGAP product: trehalose ABC transporter permease SugB
- Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=6e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215753.1)
- Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0395 - Curated reference: UniProt P9WG01 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
sugA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001326|Rv1237|sugB MGARRATYWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERAIGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG