Rv1232c Resolved · high auto-curated

H37Rv Rv1232c · MTBC0 mtbc0_001321 · 435 aa · 1383305–1384612 (-) · RefSeq NP_215748.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmagnesium transporter
Revised (this work)Magnesium transporter. Pfam: SH3_actinomycetes (PF26205.1), MgtE_N (PF03448.23), CBS (PF00571.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O86315 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namemgtE
eggNOG descriptionCBS domain
Orthologous groupCOG2239

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.308 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (497) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SH3_actinomycetesPF26205.1 3.3e-2292–164 Actinomycetes SH3 domain
MgtE_NPF03448.23 9.2e-23186–285 MgtE intracellular N domain
CBSPF00571.34 7.7e-08356–410 CBS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1231c (membrane protein), high confidence from genomic context alone (score 965 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1231c membrane protein 965 965 ctx neighborhood:882 cooccurence:713
Rv1233c hyp hypothetical protein 804 804 ctx neighborhood:801
Rv1230c membrane protein 762 762 ctx neighborhood:761
Rv1229c mrp multiple resistance/pH adaptation protein 551 551 ctx neighborhood:548
Rv1234 transmembrane protein 500 482 ctx neighborhood:480
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 433 411 ctx neighborhood:404
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 412 411 ctx neighborhood:404
Rv1237 sugB sugar ABC transporter permease SugB 408 408 ctx neighborhood:404
Rv1236 sugA sugar ABC transporter permease SugA 429 407 ctx neighborhood:404
Rv1239c corA magnesium and cobalt transport transmembrane protein CorA 436 207

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: magnesium transporter
  • Pfam (hmmscan --cut_ga): SH3_actinomycetes PF26205.1 (E=3e-22), MgtE_N PF03448.23 (E=9e-23), CBS PF00571.34 (E=8e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215748.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SH3_actinomycetes (PF26205.1), MgtE_N (PF03448.23), CBS (PF00571.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2239
  • Curated reference: UniProt O86315 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv1231c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001321|Rv1232c|
MGSVNRVYLARLSRMSVLGPLGESFGRVRDVVISISIVRQQPRVLGLVVDLATRRKIFIPILRVAAIEPHAVTLSTGNVSLHRFEQRPGEALALGQVLDTLVKVNDPALPELAGVDVVVTDLGVEQTRSRDWMVTRVAVRTQRRLRRRGPVHVVDWHNVAGLTPSALAMPGQDVAQLLDQFEGWKAVDVADAIRGLPPKRRHEVFKALHDKRLADVLQELPELDQAEVLSQLGTERAADVLEEMDPDDAADLLAVLNPTEAELLLTRMDPGDSGQVRRLLTHSPDTAGGLMTSDPVVLTPDTSIAEALARVRDPDLTPALASMVFVARPPTATPTGHYLGCVHLQRLLRDPPAELVGGVVDTDLLTLTPETPLAAVTRYFAAYNLVCGPVVDDENHLLGAVTVDDLLDHLLPHDWRVDMPELDPSGAPDRPGGPR