Rv1226c Family assigned · medium auto-curated

H37Rv Rv1226c · MTBC0 mtbc0_001314 · 487 aa · 1377276–1378739 (-) · RefSeq NP_215742.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationPH domain-containing protein
Revised (this work)PH domain-containing protein. Pfam: bPH_2 (PF03703.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33222 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial PH domain
Orthologous groupCOG3428
KEGG orthology K08981

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.708 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_2PF03703.21 7.8e-1562–141 Bacterial PH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1227c (transmembrane protein), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1227c transmembrane protein 989 988 ctx neighborhood:882 cooccurence:772 coexpression:580
Rv1225c hyp hypothetical protein 641 642 ctx neighborhood:577
Rv3365c hyp hypothetical protein 601 601 ctx cooccurence:587
Rv1228 lpqX lipoprotein LpqX 549 549 ctx neighborhood:547
Rv3877 eccD1 ESX-1 secretion system protein EccD1 533 533 ctx cooccurence:532
Rv1234 transmembrane protein 529 528 coexpression:501
Rv0901 arfC membrane protein 528 528 ctx cooccurence:526
Rv3201c adnB ATP-dependent DNA helicase 527 527 ctx cooccurence:511
Rv3882c eccE1 ESX-1 secretion system protein EccE1 517 517 ctx cooccurence:517
Rv0438c moeA2 molybdopterin molybdenumtransferase 501 502 ctx neighborhood:499
Rv3662c hyp hypothetical protein 493 493 ctx cooccurence:480
Rv1157c hyp hypothetical protein 484 485 ctx cooccurence:480
Rv3737 transmembrane protein 482 482 ctx cooccurence:463
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 479 479 ctx cooccurence:479
Rv2416c eis enhanced intracellular survival protein 471 472 ctx cooccurence:470

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: PH domain-containing protein
  • Pfam (hmmscan --cut_ga): bPH_2 PF03703.21 (E=8e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215742.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_2 (PF03703.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3428
  • Curated reference: UniProt O33222 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv1227c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001314|Rv1226c|
MTDRPHDWHRLSPRMLLVHPVHEMLRQLPVLIGSVVLGSATGNPVWPLAALGVTVVFGVLRWFFTTYRIDDENVSLRTGILSRRAVSVPRNRIRSVQTEARLLHRLLGLTVLRVGTGQEARGEAAFELDAVDSARVPRLRALLLAESLAPVEPTGRVLARWQSSWLRYAPLSFSGLVMIGAVIGLGYQTGLAVRLPESGFARSAVDAAQRAGVVLVVAVTVLLVVGVSALLAVLFSWLTYGNLLLRRGGSGQEGVLHLRHGLLRVREHTYDMRRLRGATLREPLLVRLLRGARLDAVMTGVHGEGQSSMLLPPCPFETATAVLTDLIDNTDAAAGPLRRHGPAAARRRWTRALLVPTLAGVALIAAAPILGVPGWAWTLWAVLTAGCAGLAVDRVRSLGHRVADGWLVARAGSLQRRRDCIACTGIIGWTVRQTLFQRRAGVATLVAATAAGRKGYQVLDVPAELAWSVAGAASPWVADSVWLRHGS