lppR Family assigned · medium auto-curated

H37Rv Rv2403c · MTBC0 mtbc0_002559 · 251 aa · 2724782–2725537 (-) · RefSeq NP_216919.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppR
MTBC0 PGAP re-annotationsensor domain-containing protein
Revised (this work)Sensor domain-containing protein. Pfam: PknH_C (PF14032.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71740 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved lipoprotein LppR

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelppR
eggNOG descriptionPknH-like extracellular domain
Orthologous group2AEV2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.541 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.24% of strains (343) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PknH_CPF14032.13 5.6e-4042–246 PknH-like extracellular domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lepA (GTP-binding protein LepA), high confidence from genomic context alone (score 900 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2404c lepA GTP-binding protein LepA 899 900 ctx neighborhood:881
Rv2405 hyp hypothetical protein 621 622 ctx neighborhood:620
Rv0399c lpqK lipoprotein LpqK 658 53 textmining:654
Rv1857 modA molybdate ABC transporter substrate-binding lipoprotein ModA 519 49 textmining:515
Rv0237 lpqI lipoprotein LpqI 644 47 textmining:643
Rv1016c lpqT lipoprotein LpqT 561 47 textmining:559
Rv0418 lpqL lipoprotein aminopeptidase LpqL 482 47 textmining:479
Rv3044 fecB FeIII-dicitrate-binding periplasmic lipoprotein 442 47 textmining:439
Rv1228 lpqX lipoprotein LpqX 655 46 textmining:654
Rv3244c lpqB lipoprotein LpqB 645 46 textmining:644
Rv0419 lpqM lipoprotein peptidase LpqM 630 46 textmining:628
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 434 44 textmining:433
Rv2138 lppL lipoprotein LppL 544 41 textmining:544
Rv3576 lppH lipoprotein LppH 516 41 textmining:516

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppR
  • MTBC0 PGAP product: sensor domain-containing protein
  • Pfam (hmmscan --cut_ga): PknH_C PF14032.13 (E=6e-40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216919.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PknH_C (PF14032.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AEV2
  • Curated reference: UniProt P71740 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor lepA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002559|Rv2403c|lppR
MTNRWRWVVPLFAVFLAAGCTTTTTGKAGLAPNAVPRPLMGSLIQRVPLDGAALSTLLNQPFQALPPFPPVFGGSDSLGDSDVSARPADCVGVGYLTQRNVYRSVEVKSVARVSWRHDGSSVKVDDVDEGVVALPSAAAADDLFARFSAQWKECDGTTLTVPASAFGQRSITDVRVADSVVAATVSLRRGTHSILASVPQARAVGVRGNCVVEVAVTFFGITHPSDQGSADISTSAVDIAHAMMDRISELS