Rv1217c Family assigned · low auto-curated

H37Rv Rv1217c · MTBC0 mtbc0_001305 · 548 aa · 1368597–1370243 (-) · RefSeq NP_215733.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tetronasin ABC transporter integral membrane protein
MTBC0 PGAP re-annotationmultidrug efflux ABC transporter permease
Revised (this work)Multidrug efflux ABC transporter permease.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05318 SwissProt · reviewed · Evidence at protein level
UniProt nameMultidrug efflux system permease protein Rv1217c
Curated functionProbably part of the ABC transporter complex Rv1217c-Rv1218c involved in the resistance to a wide range of structurally unrelated drugs. Probably responsible for the translocation of the substrate across the membrane (Probable).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionABC transporter
Orthologous groupCOG3559
KEGG orthology K01992
KEGG modules M00254

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.505 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 9 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (368) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1218c (tetronasin ABC transporter ATP-binding protein), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1218c tetronasin ABC transporter ATP-binding protein 999 995 ctx neighborhood:881 cooccurence:774 coexpression:830 textmining:875
Rv1216c integral membrane protein 964 954 ctx neighborhood:834 coexpression:735
Rv1219c raaS transcriptional regulator 983 919 ctx neighborhood:881 textmining:800
Rv1215c hyp hypothetical protein 936 822 ctx neighborhood:821 textmining:658
Rv1686c ABC transporter permease 878 637 ctx cooccurence:594 textmining:679
Rv1220c methyltransferase 650 552 ctx neighborhood:550
Rv1687c ABC transporter ATP-binding protein 838 526 ctx cooccurence:422 textmining:673
Rv2938 drrC daunorubicin ABC transporter permease DrrC 600 515 ctx cooccurence:499
Rv2936 drrA daunorubicin ABC transporter ATP-binding protein DrrA 687 450 textmining:456
Rv1214c PE14 PE family protein PE14 444 444 ctx neighborhood:444
Rv2937 drrB daunorubicin ABC transporter permease DrrB 558 375
Rv0677c mmpS5 membrane protein MmpS5 523 270
Rv1458c antibiotic ABC transporter ATP-binding protein 505 211
Rv1272c drug ABC transporter ATP-binding protein 460 177
Rv3065 mmr multidrug resistance protein Mmr 507 170 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tetronasin ABC transporter integral membrane protein
  • MTBC0 PGAP product: multidrug efflux ABC transporter permease
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215733.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3559
  • Curated reference: UniProt O05318 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor Rv1218c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001305|Rv1217c|
MSSTVIDRARPAGHRAPHRGSGFTGTLGLLRLYLRRDRVSLPLWVLLLSVPLATVYIASVETVYPDRSARAAAAAAIMASPAQRALYGPVYNDSLGAVGIWKAGMFHTLIAVAVILTVIRHTRADEESGRAELIDSTVVGRYANLTGALLLSFGASIATGAIGALGLLATDVAPAGSVAFGVALAASGMVFTAVAAVAAQLSPSARFTRAVAFAVLGTAFALRAIGDAGSGTLSWCSPLGWSLQVRPYAGERWWVLLLSLATAAVLTVLAYRLRAGRDVGAGLIAERPGAGTAGPMLSEPFGLAWRLNRGSLLLWTVGLCLYGLVMGSVVHGIGDQLGDNTAVRDIVTRMGGTGALEQAFLALAFTMIGMVAAAFAVSLTLRLHQEETGLRAETLLAGAVSRTHWLASHLAMALAGSAVATLISGVAAGLAYGMTVGDVGGKLPTVVGTAAVQLPAVWLLSAVTVGLFGLAPRFTPVAWGVLVGFIALYLLGSLAGFPQMLLNLEPFAHIPRVGGGDFTAVPLLWLLAIDAALITLGAMAFRRRDVRC