Rv1217c Family assigned · low auto-curated
H37Rv Rv1217c · MTBC0 mtbc0_001305 ·
548 aa · 1368597–1370243 (-) ·
RefSeq NP_215733.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | tetronasin ABC transporter integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | multidrug efflux ABC transporter permease |
| Revised (this work) | Multidrug efflux ABC transporter permease. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05318
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Multidrug efflux system permease protein Rv1217c |
| Curated function | Probably part of the ABC transporter complex Rv1217c-Rv1218c involved in the resistance to a wide range of structurally unrelated drugs. Probably responsible for the translocation of the substrate across the membrane (Probable). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| eggNOG description | ABC transporter |
| Orthologous group | COG3559 |
| KEGG orthology |
K01992
|
| KEGG modules |
M00254
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.505 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 8 synonymous, 9 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (368) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1218c (tetronasin ABC transporter ATP-binding protein), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1218c |
tetronasin ABC transporter ATP-binding protein | 999 | 995 ctx | neighborhood:881 cooccurence:774 coexpression:830 textmining:875 |
Rv1216c |
integral membrane protein | 964 | 954 ctx | neighborhood:834 coexpression:735 |
Rv1219c raaS |
transcriptional regulator | 983 | 919 ctx | neighborhood:881 textmining:800 |
Rv1215c hyp |
hypothetical protein | 936 | 822 ctx | neighborhood:821 textmining:658 |
Rv1686c |
ABC transporter permease | 878 | 637 ctx | cooccurence:594 textmining:679 |
Rv1220c |
methyltransferase | 650 | 552 ctx | neighborhood:550 |
Rv1687c |
ABC transporter ATP-binding protein | 838 | 526 ctx | cooccurence:422 textmining:673 |
Rv2938 drrC |
daunorubicin ABC transporter permease DrrC | 600 | 515 ctx | cooccurence:499 |
Rv2936 drrA |
daunorubicin ABC transporter ATP-binding protein DrrA | 687 | 450 | textmining:456 |
Rv1214c PE14 |
PE family protein PE14 | 444 | 444 ctx | neighborhood:444 |
Rv2937 drrB |
daunorubicin ABC transporter permease DrrB | 558 | 375 | |
Rv0677c mmpS5 |
membrane protein MmpS5 | 523 | 270 | |
Rv1458c |
antibiotic ABC transporter ATP-binding protein | 505 | 211 | |
Rv1272c |
drug ABC transporter ATP-binding protein | 460 | 177 | |
Rv3065 mmr |
multidrug resistance protein Mmr | 507 | 170 | textmining:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: tetronasin ABC transporter integral membrane protein
- MTBC0 PGAP product: multidrug efflux ABC transporter permease
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215733.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3559 - Curated reference: UniProt O05318 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
Rv1218c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001305|Rv1217c| MSSTVIDRARPAGHRAPHRGSGFTGTLGLLRLYLRRDRVSLPLWVLLLSVPLATVYIASVETVYPDRSARAAAAAAIMASPAQRALYGPVYNDSLGAVGIWKAGMFHTLIAVAVILTVIRHTRADEESGRAELIDSTVVGRYANLTGALLLSFGASIATGAIGALGLLATDVAPAGSVAFGVALAASGMVFTAVAAVAAQLSPSARFTRAVAFAVLGTAFALRAIGDAGSGTLSWCSPLGWSLQVRPYAGERWWVLLLSLATAAVLTVLAYRLRAGRDVGAGLIAERPGAGTAGPMLSEPFGLAWRLNRGSLLLWTVGLCLYGLVMGSVVHGIGDQLGDNTAVRDIVTRMGGTGALEQAFLALAFTMIGMVAAAFAVSLTLRLHQEETGLRAETLLAGAVSRTHWLASHLAMALAGSAVATLISGVAAGLAYGMTVGDVGGKLPTVVGTAAVQLPAVWLLSAVTVGLFGLAPRFTPVAWGVLVGFIALYLLGSLAGFPQMLLNLEPFAHIPRVGGGDFTAVPLLWLLAIDAALITLGAMAFRRRDVRC