fecB Family assigned · medium auto-curated

H37Rv Rv3044 · MTBC0 mtbc0_003236 · 359 aa · 3426446–3427525 (+) · RefSeq NP_217560.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)FeIII-dicitrate-binding periplasmic lipoprotein
MTBC0 PGAP re-annotationiron-siderophore ABC transporter substrate-binding protein
Revised (this work)Iron-siderophore ABC transporter substrate-binding protein. Pfam: Peripla_BP_2 (PF01497.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53291 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable FEIII-dicitrate-binding periplasmic lipoprotein FecB

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namefecB
eggNOG descriptionPeriplasmic binding protein
Orthologous groupCOG0614
KEGG orthology K02016
KEGG pathways map02010
KEGG modules M00240

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.718 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peripla_BP_2PF01497.24 1.1e-1792–332 Periplasmic binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0265c (iron ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 787 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0265c iron ABC transporter substrate-binding lipoprotein 849 787 ctx cooccurence:626
Rv3045 adhC NADP-dependent alcohol dehydrogenase 650 637 ctx neighborhood:626
Rv3043c ctaD cytochrome C oxidase cytochrome 1 587 587 ctx neighborhood:575
Rv3042c serB2 phosphoserine phosphatase SerB 545 545 ctx neighborhood:531
Rv3038c hyp hypothetical protein 494 494 ctx neighborhood:423
Rv0432 sodC superoxide dismutase 567 474 ctx cooccurence:468
Rv3041c ABC transporter ATP-binding protein 468 467 ctx neighborhood:438
Rv2384 mbtA 2,3-dihydroxybenzoate-AMP ligase 486 455
Rv3039c echA17 enoyl-CoA hydratase EchA17 436 436 ctx neighborhood:418
Rv3040c hyp hypothetical protein 434 433 ctx neighborhood:425
Rv2383c mbtB phenyloxazoline synthase 401 370
Rv2068c blaC beta-lactamase 442 254
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 441 246
Rv1857 modA molybdate ABC transporter substrate-binding lipoprotein ModA 523 231 textmining:407
Rv3673c membrane-anchored thioredoxin-like protein 462 231

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: FeIII-dicitrate-binding periplasmic lipoprotein
  • MTBC0 PGAP product: iron-siderophore ABC transporter substrate-binding protein
  • Pfam (hmmscan --cut_ga): Peripla_BP_2 PF01497.24 (E=1e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217560.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peripla_BP_2 (PF01497.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0614
  • Curated reference: UniProt O53291 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv0265c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003236|Rv3044|fecB
MRSTVAVAVAAAVIAASSGCGSDQPAHKASQSMITPTTQIAGAGVLGNDRKPDESCARAAAAADPGPPTRPAHNAAGVSPEMVQVPAEAQRIVVLSGDQLDALCALGLQSRIVAAALPNSSSSQPSYLGTTVHDLPGVGTRSAPDLRAIAAAHPDLILGSQGLTPQLYPQLAAIAPTVFTAAPGADWENNLRGVGAATARIAAVDALITGFAEHATQVGTKHDATHFQASIVQLTANTMRVYGANNFPASVLSAVGVDRPPSQRFTDKAYIEIGTTAADLAKSPDFSAADADIVYLSCASEAAAERAAVILDSDPWRKLSANRDNRVFVVNDQVWQTGEGMVAARGIVDDLRWVDAPIN