fecB Family assigned · medium auto-curated
H37Rv Rv3044 · MTBC0 mtbc0_003236 ·
359 aa · 3426446–3427525 (+) ·
RefSeq NP_217560.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | FeIII-dicitrate-binding periplasmic lipoprotein |
|---|---|
| MTBC0 PGAP re-annotation | iron-siderophore ABC transporter substrate-binding protein |
| Revised (this work) | Iron-siderophore ABC transporter substrate-binding protein. Pfam: Peripla_BP_2 (PF01497.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53291
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable FEIII-dicitrate-binding periplasmic lipoprotein FecB |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | fecB |
| eggNOG description | Periplasmic binding protein |
| Orthologous group | COG0614 |
| KEGG orthology |
K02016
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00240
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.718 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Peripla_BP_2 | PF01497.24 | 1.1e-17 | 92–332 | Periplasmic binding protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0265c (iron ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 787 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0265c |
iron ABC transporter substrate-binding lipoprotein | 849 | 787 ctx | cooccurence:626 |
Rv3045 adhC |
NADP-dependent alcohol dehydrogenase | 650 | 637 ctx | neighborhood:626 |
Rv3043c ctaD |
cytochrome C oxidase cytochrome 1 | 587 | 587 ctx | neighborhood:575 |
Rv3042c serB2 |
phosphoserine phosphatase SerB | 545 | 545 ctx | neighborhood:531 |
Rv3038c hyp |
hypothetical protein | 494 | 494 ctx | neighborhood:423 |
Rv0432 sodC |
superoxide dismutase | 567 | 474 ctx | cooccurence:468 |
Rv3041c |
ABC transporter ATP-binding protein | 468 | 467 ctx | neighborhood:438 |
Rv2384 mbtA |
2,3-dihydroxybenzoate-AMP ligase | 486 | 455 | |
Rv3039c echA17 |
enoyl-CoA hydratase EchA17 | 436 | 436 ctx | neighborhood:418 |
Rv3040c hyp |
hypothetical protein | 434 | 433 ctx | neighborhood:425 |
Rv2383c mbtB |
phenyloxazoline synthase | 401 | 370 | |
Rv2068c blaC |
beta-lactamase | 442 | 254 | |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 441 | 246 | |
Rv1857 modA |
molybdate ABC transporter substrate-binding lipoprotein ModA | 523 | 231 | textmining:407 |
Rv3673c |
membrane-anchored thioredoxin-like protein | 462 | 231 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: FeIII-dicitrate-binding periplasmic lipoprotein
- MTBC0 PGAP product: iron-siderophore ABC transporter substrate-binding protein
- Pfam (hmmscan --cut_ga): Peripla_BP_2 PF01497.24 (E=1e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217560.1)
- Domains: Pfam-A via hmmscan --cut_ga — Peripla_BP_2 (PF01497.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0614 - Curated reference: UniProt O53291 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
Rv0265c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003236|Rv3044|fecB MRSTVAVAVAAAVIAASSGCGSDQPAHKASQSMITPTTQIAGAGVLGNDRKPDESCARAAAAADPGPPTRPAHNAAGVSPEMVQVPAEAQRIVVLSGDQLDALCALGLQSRIVAAALPNSSSSQPSYLGTTVHDLPGVGTRSAPDLRAIAAAHPDLILGSQGLTPQLYPQLAAIAPTVFTAAPGADWENNLRGVGAATARIAAVDALITGFAEHATQVGTKHDATHFQASIVQLTANTMRVYGANNFPASVLSAVGVDRPPSQRFTDKAYIEIGTTAADLAKSPDFSAADADIVYLSCASEAAAERAAVILDSDPWRKLSANRDNRVFVVNDQVWQTGEGMVAARGIVDDLRWVDAPIN