mrp Family assigned · medium auto-curated

H37Rv Rv1229c · MTBC0 mtbc0_001318 · 390 aa · 1380221–1381393 (-) · RefSeq NP_215745.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)multiple resistance/pH adaptation protein
MTBC0 PGAP re-annotationMrp/NBP35 family ATP-binding protein
Revised (this work)Mrp/NBP35 family ATP-binding protein. Pfam: FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJN7 SwissProt · reviewed · Evidence at protein level
UniProt nameIron-sulfur cluster carrier protein
Curated functionBinds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
Preferred namemrp
eggNOG descriptionBinds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP
Orthologous groupCOG0489
KEGG orthology K03593
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.37 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FeS_assembly_PPF01883.25 2.8e-1720–92 Iron-sulfur cluster assembly protein
ParAPF10609.16 5.0e-85126–370 NUBPL iron-transfer P-loop NTPase
AAA_31PF13614.13 3.3e-07127–169 AAA domain
CbiAPF01656.30 1.1e-12130–350 CobQ/CobB/MinD/ParA nucleotide binding domain
MipZPF09140.18 8.4e-07130–246 ATPase MipZ

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1230c (membrane protein), high confidence from genomic context alone (score 809 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 887 857 database:832
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 883 848 database:832
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 845 836 database:832
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 869 834 database:832
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 831 811 database:777
Rv1230c membrane protein 809 809 ctx neighborhood:803
Rv0310c hyp hypothetical protein 814 808 database:798
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 804 777 database:773
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 806 776 database:773
Rv1364c sigma factor regulatory protein 623 610 ctx neighborhood:424
Rv3396c guaA GMP synthase 626 573
Rv1231c membrane protein 566 566 ctx neighborhood:561
Rv1232c hyp hypothetical protein 551 551 ctx neighborhood:548
Rv2733c miaB (dimethylallyl)adenosine tRNA methylthiotransferase 655 549 ctx cooccurence:545
Rv1329c dinG ATP-dependent helicase DinG 512 483 database:480

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: multiple resistance/pH adaptation protein
  • MTBC0 PGAP product: Mrp/NBP35 family ATP-binding protein
  • Pfam (hmmscan --cut_ga): FeS_assembly_P PF01883.25 (E=3e-17), ParA PF10609.16 (E=5e-85), AAA_31 PF13614.13 (E=3e-07), CbiA PF01656.30 (E=1e-12), MipZ PF09140.18 (E=8e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215745.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0489
  • Curated reference: UniProt P9WJN7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor Rv1230c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001318|Rv1229c|mrp
MPSRLHSAVMSGTRDGDLNAAIRTALGKVIDPELRRPITELGMVKSIDTGPDGSVHVEIYLTIAGCPKKSEITERVTRAVADVPGTSAVRVSLDVMSDEQRTELRKQLRGDTREPVIPFAQPDSLTRVYAVASGKGGVGKSTVTVNLAAAMAVRGLSIGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHQVKVISIAQFTQGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDVAISVAQLIPNAELLVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTLPDGTTMQVFGEGGGRLVAERLSRAVGADVPLLGQIPLDPALVAAGDSGVPLVLSSPDSAIGKELHSIADGLSTRRRGLAGMSLGLDPTRR