mrp Family assigned · medium auto-curated
H37Rv Rv1229c · MTBC0 mtbc0_001318 ·
390 aa · 1380221–1381393 (-) ·
RefSeq NP_215745.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | multiple resistance/pH adaptation protein |
|---|---|
| MTBC0 PGAP re-annotation | Mrp/NBP35 family ATP-binding protein |
| Revised (this work) | Mrp/NBP35 family ATP-binding protein. Pfam: FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJN7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Iron-sulfur cluster carrier protein |
| Curated function | Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | mrp |
| eggNOG description | Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP |
| Orthologous group | COG0489 |
| KEGG orthology |
K03593
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.37 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FeS_assembly_P | PF01883.25 | 2.8e-17 | 20–92 | Iron-sulfur cluster assembly protein |
ParA | PF10609.16 | 5.0e-85 | 126–370 | NUBPL iron-transfer P-loop NTPase |
AAA_31 | PF13614.13 | 3.3e-07 | 127–169 | AAA domain |
CbiA | PF01656.30 | 1.1e-12 | 130–350 | CobQ/CobB/MinD/ParA nucleotide binding domain |
MipZ | PF09140.18 | 8.4e-07 | 130–246 | ATPase MipZ |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1230c (membrane protein), high confidence from genomic context alone (score 809 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 887 | 857 | database:832 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 883 | 848 | database:832 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 845 | 836 | database:832 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 869 | 834 | database:832 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 831 | 811 | database:777 |
Rv1230c |
membrane protein | 809 | 809 ctx | neighborhood:803 |
Rv0310c hyp |
hypothetical protein | 814 | 808 | database:798 |
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 804 | 777 | database:773 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 806 | 776 | database:773 |
Rv1364c |
sigma factor regulatory protein | 623 | 610 ctx | neighborhood:424 |
Rv3396c guaA |
GMP synthase | 626 | 573 | |
Rv1231c |
membrane protein | 566 | 566 ctx | neighborhood:561 |
Rv1232c hyp |
hypothetical protein | 551 | 551 ctx | neighborhood:548 |
Rv2733c miaB |
(dimethylallyl)adenosine tRNA methylthiotransferase | 655 | 549 ctx | cooccurence:545 |
Rv1329c dinG |
ATP-dependent helicase DinG | 512 | 483 | database:480 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: multiple resistance/pH adaptation protein
- MTBC0 PGAP product: Mrp/NBP35 family ATP-binding protein
- Pfam (hmmscan --cut_ga): FeS_assembly_P PF01883.25 (E=3e-17), ParA PF10609.16 (E=5e-85), AAA_31 PF13614.13 (E=3e-07), CbiA PF01656.30 (E=1e-12), MipZ PF09140.18 (E=8e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215745.1)
- Domains: Pfam-A via hmmscan --cut_ga — FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0489 - Curated reference: UniProt P9WJN7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
Rv1230c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001318|Rv1229c|mrp MPSRLHSAVMSGTRDGDLNAAIRTALGKVIDPELRRPITELGMVKSIDTGPDGSVHVEIYLTIAGCPKKSEITERVTRAVADVPGTSAVRVSLDVMSDEQRTELRKQLRGDTREPVIPFAQPDSLTRVYAVASGKGGVGKSTVTVNLAAAMAVRGLSIGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHQVKVISIAQFTQGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDVAISVAQLIPNAELLVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTLPDGTTMQVFGEGGGRLVAERLSRAVGADVPLLGQIPLDPALVAAGDSGVPLVLSSPDSAIGKELHSIADGLSTRRRGLAGMSLGLDPTRR