mrp Family assigned · medium auto-curated
H37Rv Rv1229c · MTBC0 mtbc0_001318 ·
390 aa ·
1380221–1381393 MTBC0
(-) ·
RefSeq NP_215745.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | multiple resistance/pH adaptation protein |
|---|---|
| MTBC0 PGAP re-annotation | Mrp/NBP35 family ATP-binding protein |
| Revised (this work) | Mrp/NBP35 family ATP-binding protein. Pfam: FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (9 in a M. tuberculosis context, 3 in other mycobacteria — M. abscessus (1), M. leprae (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Osteogenic Sarcoma in an Adolescent With Cystic Fibrosis: Successful Treatment Despite Significant Obstacles. doi:10.3389/fped.2018.00245 | 2018 |
| Reversal of multidrug resistance by the inhibition of ATP-binding cassette pumps employing "Generally Recognized As Safe" (GRAS) nanopharmaceuticals: A review. doi:10.1016/j.addr.2013.09.002 | 2013 |
| [Expression of P-glycoprotein and multidrug resistance-associated protein in peripheral blood mononuclear cells from multidrug resistant tuberculosis patients]. | 2011 |
| High expression of myeloid-related proteins 8 and 14 characterizes an inflammatorily active but ineffective response of macrophages during leprosy. doi:10.1111/j.0019-2805.2004.01836.x | 2004 |
| [Septic loosening of a Wagner revision stem provoked by Mycobacterium tuberculosis]. doi:10.1007/s00132-003-0501-7 | 2003 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -2.72 (95% CI -3.30 to -2.09). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Unknown: thought to be a ATP-binding protein. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1261c
· 100.0% identity |
|---|---|
| M. leprae |
ML1080c
· 82.1% identity |
| M. marinum |
MMAR_4212
· 86.3% identity |
| M. smegmatis |
MSMEG_5068
· 82.7% identity |
| M. orygis |
RJtmp_001295
· 100.0% identity |
| M. abscessus |
MAB_1366c
· 77.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJN7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Iron-sulfur cluster carrier protein |
| Curated function | Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | mrp |
| eggNOG description | Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP |
| Orthologous group | COG0489 |
| KEGG orthology |
K03593
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.37 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 87.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 17 in the ORF — 14 in the essential state, 0 growth-defect, 2 non-essential, 1 growth-advantage. Saturation 0.176, mean read count 65.3333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1229c-mrp_2.1 (TetON promoter 2) |
|---|---|
| Baseline knockdown fitness | 1.329 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 131.0 ppm · rank 1103/3519 (68.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 390 aa |
|---|---|
| Molecular weight | 41.1 kDa |
| Theoretical pI | 6.19 |
| GRAVY | 0.079 (hydrophobic) |
| Aliphatic index | 104.2 |
| Aromaticity | 0.023 |
| Instability index | 33.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FeS_assembly_P | PF01883.25 | 2.8e-17 | 20–92 | Iron-sulfur cluster assembly protein |
ParA | PF10609.16 | 5.0e-85 | 126–370 | NUBPL iron-transfer P-loop NTPase |
AAA_31 | PF13614.13 | 3.3e-07 | 127–169 | AAA domain |
CbiA | PF01656.30 | 1.1e-12 | 130–350 | CobQ/CobB/MinD/ParA nucleotide binding domain |
MipZ | PF09140.18 | 8.4e-07 | 130–246 | ATPase MipZ |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8zkc-assembly1_A-2 |
1.00 | 0.66 | 5.9e-27 sig | 8zkc-assembly1_A-2 iron-sulfur cluster transfer protein ApbC |
5aup-assembly1_I |
1.00 | 0.82 | 1.1e-17 sig | 5aup-assembly1_I Crystal structure of the HypAB complex |
5aun-assembly1_B |
1.00 | 0.84 | 5.1e-17 sig | 5aun-assembly1_B Crystal structure of the HypAB-Ni complex |
3vx3-assembly1_B |
1.00 | 0.83 | 2.4e-17 sig | 3vx3-assembly1_B Crystal structure of [NiFe] hydrogenase maturation protein HypB from Thermococcus kodakarensis KOD1 |
2ph1-assembly1_A |
1.00 | 0.77 | 7.1e-18 sig | 2ph1-assembly1_A Crystal structure of nucleotide-binding protein AF2382 from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR165 |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1228a (+ strand, 74 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1230c (- strand, 12 bp gap) |
| Predicted operon |
mrp · Rv1230c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0023 (represses) · Rv0081 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1230c (membrane protein), high confidence from genomic context alone (score 809 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3148 nuoD exp |
NADH-quinone oxidoreductase subunit D | 887 | 857 | database:832 |
Rv3153 nuoI exp |
NADH-quinone oxidoreductase subunit I | 883 | 848 | database:832 |
Rv3146 nuoB exp |
NADH-quinone oxidoreductase subunit B | 845 | 836 | database:832 |
Rv3147 nuoC exp |
NADH-quinone oxidoreductase subunit C | 869 | 834 | database:832 |
Rv3151 nuoG exp |
NADH-quinone oxidoreductase subunit G | 831 | 811 | database:777 |
Rv1230c |
membrane protein | 809 | 809 ctx | neighborhood:803 |
Rv0310c hyp exp |
hypothetical protein | 814 | 808 | database:798 |
Rv3150 nuoF exp |
NADH-quinone oxidoreductase subunit F | 804 | 777 | database:773 |
Rv3149 nuoE exp |
NADH-quinone oxidoreductase subunit E | 806 | 776 | database:773 |
Rv1364c |
sigma factor regulatory protein | 623 | 610 ctx | neighborhood:424 |
Rv3396c guaA |
GMP synthase | 626 | 573 | |
Rv1231c |
membrane protein | 566 | 566 ctx | neighborhood:561 |
Rv1232c hyp |
hypothetical protein | 551 | 551 ctx | neighborhood:548 |
Rv2733c miaB |
(dimethylallyl)adenosine tRNA methylthiotransferase | 655 | 549 ctx | cooccurence:545 |
Rv1329c dinG exp |
ATP-dependent helicase DinG | 512 | 483 | database:480 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: multiple resistance/pH adaptation protein
- MTBC0 PGAP product: Mrp/NBP35 family ATP-binding protein
- Pfam (hmmscan --cut_ga): FeS_assembly_P PF01883.25 (E=3e-17), ParA PF10609.16 (E=5e-85), AAA_31 PF13614.13 (E=3e-07), CbiA PF01656.30 (E=1e-12), MipZ PF09140.18 (E=8e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215745.1)
- Domains: Pfam-A via hmmscan --cut_ga — FeS_assembly_P (PF01883.25), ParA (PF10609.16), AAA_31 (PF13614.13), CbiA (PF01656.30), MipZ (PF09140.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0489 - Curated reference: UniProt P9WJN7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
Rv1230c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001318|Rv1229c|mrp MPSRLHSAVMSGTRDGDLNAAIRTALGKVIDPELRRPITELGMVKSIDTGPDGSVHVEIYLTIAGCPKKSEITERVTRAVADVPGTSAVRVSLDVMSDEQRTELRKQLRGDTREPVIPFAQPDSLTRVYAVASGKGGVGKSTVTVNLAAAMAVRGLSIGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHQVKVISIAQFTQGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDVAISVAQLIPNAELLVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTLPDGTTMQVFGEGGGRLVAERLSRAVGADVPLLGQIPLDPALVAAGDSGVPLVLSSPDSAIGKELHSIADGLSTRRRGLAGMSLGLDPTRR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mrp? Email the maintainer — the message is pre-filled with this gene's details.