sigE Resolved · high auto-curated

H37Rv Rv1221 · MTBC0 mtbc0_001309 · 257 aa · 1372855–1373628 (+) · RefSeq NP_215737.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ECF RNA polymerase sigma factor SigE
MTBC0 PGAP re-annotationRNA polymerase sigma factor SigE
Revised (this work)RNA polymerase sigma factor SigE. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGG7 SwissProt · reviewed · Evidence at protein level
UniProt nameECF RNA polymerase sigma factor SigE
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released. Responds to heat shock and surface stress (detergent exposure). When combined with isolated core RNA polymerase from M.smegmatis is able to guide initiation from the sigB promoter. Required for full expression of sigB, and for sigB induction after detergent exposure but not after heat shock. Controls a regulon of about 38 genes in culture and about.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigE
eggNOG descriptionBelongs to the sigma-70 factor family. ECF subfamily
Orthologous groupCOG1595
KEGG orthology K03088
Gene Ontology (68) GO:0000302, GO:0000988, GO:0000990, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009266 +56 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.108 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 1.4e-2287–153 Sigma-70 region 2
Sigma70_r4_2PF08281.19 3.1e-17186–236 Sigma-70, region 4
Sigma70_r4PF04545.23 6.2e-14189–237 Sigma-70, region 4

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rseA (anti-sigma E factor RseA), high confidence from genomic context alone (score 789 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1222 rseA anti-sigma E factor RseA 859 789 ctx neighborhood:614
Rv2710 sigB RNA polymerase sigma factor SigB 837 739 coexpression:738 textmining:402
Rv3414c sigD ECF RNA polymerase sigma factor SigD 551 552 ctx cooccurence:549
Rv1220c methyltransferase 550 551 ctx neighborhood:551
Rv1223 htrA serine protease HtrA 535 517 ctx neighborhood:490
Rv1224 tatB Sec-independent protein translocase protein TatB 509 509 ctx neighborhood:490
Rv3221A rshA anti-sigma factor RshA 701 492 textmining:437
Rv0736 rslA anti-sigma-L factor RslA 510 487
Rv2782c pepR zinc protease 483 483 ctx cooccurence:468
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 488 460 experimental:456
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 484 456 experimental:451
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 473 443 experimental:431
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 464 435 experimental:431
Rv0445c sigK ECF RNA polymerase sigma factor SigK 415 415 ctx cooccurence:413
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 412 413 coexpression:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigE
  • MTBC0 PGAP product: RNA polymerase sigma factor SigE
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=1e-22), Sigma70_r4_2 PF08281.19 (E=3e-17), Sigma70_r4 PF04545.23 (E=6e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215737.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1595
  • Curated reference: UniProt P9WGG7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor rseA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001309|Rv1221|sigE
MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR