lpqI Resolved · high auto-curated

H37Rv Rv0237 · MTBC0 - · 388 aa · 287186–288352 (+) · RefSeq YP_177702.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqI
MTBC0 PGAP re-annotation
Revised (this work)Lipoprotein LpqI. Pfam: Glyco_hydro_3 (PF00933.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6B0 SwissProt · reviewed · Evidence at protein level
UniProt nameBeta-hexosaminidase LpqI
EC (curated) EC 3.2.1.52
Curated functionPlays a role in peptidoglycan recycling by cleaving the terminal beta-1,4-linked N-acetylglucosamine (GlcNAc) from peptidoglycan fragments. Acts as a regulator for GlcNAc-MurNAc levels by cleaving disaccharides and allowing the breakdown of MurNAc.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namelpqI
eggNOG descriptionhydrolase, family 3
Orthologous groupCOG1472
EC number EC 3.2.1.52
KEGG orthology K01207
KEGG pathways map00520, map00531, map01100, map01501
KEGG modules M00628

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.038 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glyco_hydro_3PF00933.28 5.4e-8862–378 Glycosyl hydrolase family 3 N terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0238 (transcriptional regulator), high confidence from genomic context alone (score 746 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0236A hyp hypothetical protein 781 781 ctx neighborhood:778
Rv0238 transcriptional regulator 746 746 ctx neighborhood:743
Rv0236c aftD alpha-(1->3)-arabinofuranosyltransferase 583 561 ctx neighborhood:555
Rv0838 lpqR lipoprotein LpqR 454 454 ctx fusion:452
Rv0239 vapB24 antitoxin VapB24 444 444 ctx neighborhood:440
Rv0240 vapC24 ribonuclease VapC24 443 444 ctx neighborhood:440
Rv3332 nagA N-acetylglucosamine-6-phosphate deacetylase NagA 897 424 textmining:830
Rv0235c transmembrane protein 415 415 ctx neighborhood:415
Rv3242c hyp hypothetical protein 404 404 coexpression:400
Rv0418 lpqL lipoprotein aminopeptidase LpqL 634 217 textmining:552
Rv0399c lpqK lipoprotein LpqK 708 207 textmining:647
Rv2525c hyp hypothetical protein 491 197
Rv3044 fecB FeIII-dicitrate-binding periplasmic lipoprotein 539 181 textmining:461
Rv3244c lpqB lipoprotein LpqB 591 79 textmining:575
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 465 74 textmining:446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipoprotein LpqI
  • Pfam (hmmscan --cut_ga): Glyco_hydro_3 PF00933.28 (E=5e-88)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177702.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyco_hydro_3 (PF00933.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1472
  • Curated reference: UniProt L7N6B0 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor Rv0238
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0237|lpqI
MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCAEPAGIPALLSPRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDGALAEIVAGGGPLPLAVSVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRGRQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGVTTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYGAPPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPAVLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR