tatB Resolved · high auto-curated
H37Rv Rv1224 · MTBC0 mtbc0_001312 ·
131 aa · 1375907–1376302 (+) ·
RefSeq NP_215740.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Sec-independent protein translocase protein TatB |
|---|---|
| MTBC0 PGAP re-annotation | Sec-independent protein translocase protein TatB |
| Revised (this work) | Sec-independent protein translocase protein TatB. Pfam: TatA_B_E (PF02416.22). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WG99
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Sec-independent protein translocase protein TatB |
| Curated function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accommodates folded Tat precursor proteins before their translocation. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
U Intracellular trafficking, secretion and vesicular transport
|
|---|---|
| Preferred name | tatB |
| eggNOG description | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accommodates folded Tat precursor proteins before their translocation |
| Orthologous group | COG1826 |
| KEGG orthology |
K03117
|
| KEGG pathways |
map03060, map03070
|
| KEGG modules |
M00336
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TatA_B_E | PF02416.22 | 7.7e-14 | 4–49 | mttA/Hcf106 family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: htrA (serine protease HtrA), high confidence from genomic context alone (score 966 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1223 htrA |
serine protease HtrA | 967 | 966 ctx | neighborhood:881 coexpression:730 |
Rv3396c guaA |
GMP synthase | 935 | 933 | coexpression:921 |
Rv2093c tatC |
Sec-independent protein translocase transmembrane protein TatC | 984 | 930 | coexpression:710 experimental:629 textmining:782 |
Rv1222 rseA |
anti-sigma E factor RseA | 804 | 804 ctx | neighborhood:659 |
Rv1337 |
integral membrane protein | 680 | 652 | experimental:467 |
Rv1221 sigE |
ECF RNA polymerase sigma factor SigE | 509 | 509 ctx | neighborhood:490 |
Rv3335c yhjD |
integral membrane protein | 509 | 490 ctx | cooccurence:415 |
Rv0110 |
integral membrane protein | 511 | 468 | experimental:467 |
Rv3221A rshA |
anti-sigma factor RshA | 454 | 455 | |
Rv2553c mltG |
membrane protein | 449 | 449 | coexpression:449 |
Rv0846c mmcO |
oxidase | 469 | 436 | experimental:415 |
Rv0799c hyp |
hypothetical protein | 822 | 435 | coexpression:403 textmining:698 |
Rv2122c hisE |
phosphoribosyl-ATP pyrophosphatase | 425 | 426 | |
Rv3607c folB |
dihydroneopterin aldolase | 425 | 425 | coexpression:423 |
Rv3013 hyp |
hypothetical protein | 422 | 422 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Sec-independent protein translocase protein TatB
- MTBC0 PGAP product: Sec-independent protein translocase protein TatB
- Pfam (hmmscan --cut_ga): TatA_B_E PF02416.22 (E=8e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215740.1)
- Domains: Pfam-A via hmmscan --cut_ga — TatA_B_E (PF02416.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1826 - Curated reference: UniProt P9WG99 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
48 functional partner(s); context anchor
htrA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001312|Rv1224|tatB MFANIGWGEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIGAGPIPFDSDAT