tatB Resolved · high auto-curated

H37Rv Rv1224 · MTBC0 mtbc0_001312 · 131 aa · 1375907–1376302 (+) · RefSeq NP_215740.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Sec-independent protein translocase protein TatB
MTBC0 PGAP re-annotationSec-independent protein translocase protein TatB
Revised (this work)Sec-independent protein translocase protein TatB. Pfam: TatA_B_E (PF02416.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG99 SwissProt · reviewed · Inferred from homology
UniProt nameSec-independent protein translocase protein TatB
Curated functionPart of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accommodates folded Tat precursor proteins before their translocation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred nametatB
eggNOG descriptionPart of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accommodates folded Tat precursor proteins before their translocation
Orthologous groupCOG1826
KEGG orthology K03117
KEGG pathways map03060, map03070
KEGG modules M00336
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TatA_B_EPF02416.22 7.7e-144–49 mttA/Hcf106 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: htrA (serine protease HtrA), high confidence from genomic context alone (score 966 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1223 htrA serine protease HtrA 967 966 ctx neighborhood:881 coexpression:730
Rv3396c guaA GMP synthase 935 933 coexpression:921
Rv2093c tatC Sec-independent protein translocase transmembrane protein TatC 984 930 coexpression:710 experimental:629 textmining:782
Rv1222 rseA anti-sigma E factor RseA 804 804 ctx neighborhood:659
Rv1337 integral membrane protein 680 652 experimental:467
Rv1221 sigE ECF RNA polymerase sigma factor SigE 509 509 ctx neighborhood:490
Rv3335c yhjD integral membrane protein 509 490 ctx cooccurence:415
Rv0110 integral membrane protein 511 468 experimental:467
Rv3221A rshA anti-sigma factor RshA 454 455
Rv2553c mltG membrane protein 449 449 coexpression:449
Rv0846c mmcO oxidase 469 436 experimental:415
Rv0799c hyp hypothetical protein 822 435 coexpression:403 textmining:698
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 425 426
Rv3607c folB dihydroneopterin aldolase 425 425 coexpression:423
Rv3013 hyp hypothetical protein 422 422

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Sec-independent protein translocase protein TatB
  • MTBC0 PGAP product: Sec-independent protein translocase protein TatB
  • Pfam (hmmscan --cut_ga): TatA_B_E PF02416.22 (E=8e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215740.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TatA_B_E (PF02416.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1826
  • Curated reference: UniProt P9WG99 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor htrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001312|Rv1224|tatB
MFANIGWGEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIGAGPIPFDSDAT