Rv1234 Resolved · high auto-curated

H37Rv Rv1234 · MTBC0 mtbc0_001323 · 175 aa · 1385420–1385947 (+) · RefSeq NP_215750.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationgeneral stress protein
Revised (this work)General stress protein. Pfam: YflT (PF11181.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O50451 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2CAW2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.122 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YflTPF11181.14 2.6e-2337–114 Heat induced stress protein YflT domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqY (trehalose ABC transporter substrate-binding lipoprotein LpqY), high confidence from genomic context alone (score 855 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 855 855 ctx neighborhood:853
Rv1236 sugA sugar ABC transporter permease SugA 850 849 ctx neighborhood:847
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 846 846 ctx neighborhood:845
Rv1237 sugB sugar ABC transporter permease SugB 846 846 ctx neighborhood:844
Rv1364c sigma factor regulatory protein 842 834 coexpression:831
Rv1244 lpqZ lipoprotein LpqZ 790 791 coexpression:705
Rv3759c proX glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX 739 740 coexpression:706
Rv3470c ilvB2 acetolactate synthase large subunit 735 725 coexpression:724
Rv1876 bfrA bacterioferritin BfrA 664 646 coexpression:646
Rv1231c membrane protein 640 640 ctx neighborhood:527
Rv3278c transmembrane protein 585 584 coexpression:498
Rv1233c hyp hypothetical protein 538 538 ctx neighborhood:533
Rv1209 hyp hypothetical protein 536 536 ctx cooccurence:534
Rv1226c transmembrane protein 529 528 coexpression:501
Rv0862c hyp hypothetical protein 524 524 ctx cooccurence:504

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: general stress protein
  • Pfam (hmmscan --cut_ga): YflT PF11181.14 (E=3e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215750.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YflT (PF11181.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CAW2
  • Curated reference: UniProt O50451 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor lpqY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001323|Rv1234|
MTSPFQPRQVPGSTPAAAGAGRRGVPALPTPPKGWPVGSYPTYAEAQRAVDYLSEQQFPVQQVTIVGVDLMQVERVTGRLTWPKVLGGGVLSGAWLGLFIGLVLGFFSPNPWSALVTGLVAGVFFGLITSAVPYAMARGTRDFSSTMQLVAGRYDVLCDPQNAEKARDLLARLAI