lppH Resolved · high auto-curated

H37Rv Rv3576 · MTBC0 - · 237 aa · 4018358–4019071 (+) · RefSeq YP_177991.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppH
MTBC0 PGAP re-annotation
Revised (this work)Lipoprotein LppH. Pfam: PknH_C (PF14032.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6YGJ4 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved lipoprotein LppH

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
L Replication, recombination and repair
T Signal transduction mechanisms
Preferred namelppH
eggNOG descriptionPknH-like extracellular domain
Orthologous groupCOG0515

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.411 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.60% of strains (871) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PknH_CPF14032.13 5.2e-6044–233 PknH-like extracellular domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: arsB2 (arsenic transport integral membrane protein ArsB), medium confidence from genomic context alone (score 583 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3577 hyp hypothetical protein 746 746 ctx neighborhood:738
Rv3578 arsB2 arsenic transport integral membrane protein ArsB 584 583 ctx neighborhood:581
Rv3575c LacI family transcriptional regulator 583 562 ctx neighborhood:562
Rv2060 integral membrane protein 538 538 ctx neighborhood:538
Rv2059 hyp hypothetical protein 550 532 ctx neighborhood:531
Rv1747 ABC transporter ATP-binding protein/permease 460 388
Rv2339 mmpL9 transmembrane transport protein MmpL9 581 172 textmining:515
Rv2116 lppK lipoprotein LppK 709 83 textmining:697
Rv3759c proX glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX 523 80 textmining:503
Rv0835 lpqQ lipoprotein LpqQ 630 65 textmining:621
Rv1274 lprB lipoprotein LprB 610 63 textmining:602
Rv1275 lprC lipoprotein LprC 523 62 textmining:513
Rv2291 sseB thiosulfate sulfurtransferase SseB 525 56 textmining:518
Rv2138 lppL lipoprotein LppL 436 53 textmining:429
Rv1857 modA molybdate ABC transporter substrate-binding lipoprotein ModA 409 53 textmining:402

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipoprotein LppH
  • Pfam (hmmscan --cut_ga): PknH_C PF14032.13 (E=5e-60)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177991.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PknH_C (PF14032.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0515
  • Curated reference: UniProt I6YGJ4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor arsB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3576|lppH
MGKQLAALAALVGACMLAAGCTNVVDGTAVAADKSGPLHQDPIPVSALEGLLLDLSQINAALGATSMKVWFNAKAMWDWSKSVADKNCLAIDGPAQEKVYAGTGWTAMRGQRLDDSIDDSKKRDHYAIQAVVGFPTAHDAEEFYSSSVQSWSSCSNRRFVEVTPGQDDAAWTVADVVNDNGMLSSSQVQEGGDGWTCQRALTARNNVTIDIVTCAYSQPDLVAIGIANQIAAKVAKQ