lpqK Family assigned · medium auto-curated

H37Rv Rv0399c · MTBC0 mtbc0_000419 · 409 aa · 480691–481920 (-) · RefSeq NP_214913.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqK
MTBC0 PGAP re-annotationserine hydrolase domain-containing protein
Revised (this work)Serine hydrolase domain-containing protein. Pfam: Beta-lactamase (PF00144.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95207 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved lipoprotein LpqK

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namelpqK
eggNOG descriptionbeta-lactamase
Orthologous groupCOG1680

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.381 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 12 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.45% of strains (659) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Beta-lactamasePF00144.30 7.0e-5542–388 Beta-lactamase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE7 (acyl-CoA dehydrogenase FadE7), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0400c fadE7 acyl-CoA dehydrogenase FadE7 887 887 ctx neighborhood:882
Rv0398c hyp hypothetical protein 882 882 ctx neighborhood:881
Rv0907 hyp hypothetical protein 738 739 ctx cooccurence:736
Rv0401 transmembrane protein 649 649 ctx neighborhood:649
Rv3372 otsB2 trehalose 6-phosphate phosphatase 546 547 ctx neighborhood:544
Rv2305 hyp hypothetical protein 509 510 ctx cooccurence:495
Rv1367c hyp hypothetical protein 503 503 ctx cooccurence:496
Rv1215c hyp hypothetical protein 425 425 ctx cooccurence:406
Rv0237 lpqI lipoprotein LpqI 708 207 textmining:647
Rv1368 lprF lipoprotein LprF 411 167
Rv3627c dacB hyp hypothetical protein 423 56 textmining:414
Rv2403c lppR lipoprotein LppR 658 53 textmining:654
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 459 52 textmining:454
Rv0483 lprQ lipoprotein LprQ 420 52 textmining:414
Rv1857 modA molybdate ABC transporter substrate-binding lipoprotein ModA 519 51 textmining:514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqK
  • MTBC0 PGAP product: serine hydrolase domain-containing protein
  • Pfam (hmmscan --cut_ga): Beta-lactamase PF00144.30 (E=7e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214913.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Beta-lactamase (PF00144.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1680
  • Curated reference: UniProt P95207 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor fadE7
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000419|Rv0399c|lpqK
MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIVRDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLKLVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQWTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGLTATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIYDMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGHWLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAPNDAPPMPPGR