sugC Family assigned · medium auto-curated

H37Rv Rv1238 · MTBC0 mtbc0_001327 · 393 aa · 1389128–1390309 (+) · RefSeq NP_215754.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar ABC transporter ATP-binding protein SugC
MTBC0 PGAP re-annotationtrehalose ABC transporter ATP-binding protein SugC
Revised (this work)Trehalose ABC transporter ATP-binding protein SugC. Pfam: ABC_tran (PF00005.34), OB_MalK (PF17912.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQI3 SwissProt · reviewed · Evidence at protein level
UniProt nameTrehalose import ATP-binding protein SugC
EC (curated) EC 7.5.2.-
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Responsible for energy coupling to the transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namesugC
eggNOG descriptionBelongs to the ABC transporter superfamily
Orthologous groupCOG3842
KEGG orthology K10112
KEGG pathways map02010
KEGG modules M00194, M00196, M00197, M00200, M00201, M00206, M00207, M00491, M00602, M00605, M00606
Gene Ontology (17) GO:0006810, GO:0008150, GO:0008643, GO:0009405, GO:0015766, GO:0015771, GO:0015772, GO:0040007, GO:0044110, GO:0044116, GO:0044117, GO:0044403 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.31 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 2.2e-3221–162 ABC transporter
OB_MalKPF17912.8 1.6e-11236–287 MalK OB fold domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sugB (sugar ABC transporter permease SugB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1237 sugB sugar ABC transporter permease SugB 999 1000 ctx neighborhood:881 cooccurence:771 coexpression:463 experimental:997 database:900 textmining:900
Rv1236 sugA sugar ABC transporter permease SugA 999 1000 ctx neighborhood:881 cooccurence:769 coexpression:476 experimental:788 database:900 textmining:949
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 999 995 ctx neighborhood:881 cooccurence:477 coexpression:469 experimental:870 textmining:964
Rv2316 uspA sugar ABC transporter permease UspA 949 932 ctx cooccurence:767 coexpression:465 experimental:458
Rv2040c sugar ABC transporter permease 940 932 ctx cooccurence:771 coexpression:466 experimental:458
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 934 925 ctx cooccurence:743 coexpression:463 experimental:458
Rv2039c sugar ABC transporter permease 948 924 ctx cooccurence:768 coexpression:439 experimental:441
Rv2317 uspB sugar ABC transporter permease UspB 947 922 ctx cooccurence:762 coexpression:439 experimental:441
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 937 920 ctx cooccurence:759 coexpression:436 experimental:441
Rv2038c ugpC sugar ABC transporter ATP-binding protein 906 905 database:900
Rv1234 transmembrane protein 846 846 ctx neighborhood:845
Rv2041c sugar ABC transporter substrate-binding lipoprotein 879 833 ctx cooccurence:444 coexpression:466 experimental:444
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 843 758 coexpression:466 experimental:469
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 887 669 coexpression:469 textmining:675
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 584 570 database:540

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar ABC transporter ATP-binding protein SugC
  • MTBC0 PGAP product: trehalose ABC transporter ATP-binding protein SugC
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=2e-32), OB_MalK PF17912.8 (E=2e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215754.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), OB_MalK (PF17912.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3842
  • Curated reference: UniProt P9WQI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor sugB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001327|Rv1238|sugC
MAEIVLDHVNKSYPDGHTAVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSGELRIAGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMRKADIAQKVSETAKILDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEIAQLQRRLGTTTVYVTHDQTEAMTLGDRVVVMYGGIAQQIGTPEELYERPANLFVAGFIGSPAMNFFPARLTAIGLTLPFGEVTLAPEVQGVIAAHPKPENVIVGVRPEHIQDAALIDAYQRIRALTFQVKVNLVESLGADKYLYFTTESPAVHSVQLDELAEVEGESALHENQFVARVPAESKVAIGQSVELAFDTARLAVFDADSGANLTIPHRA