lpqY Family assigned · medium auto-curated

H37Rv Rv1235 · MTBC0 mtbc0_001324 · 468 aa · 1385968–1387374 (+) · RefSeq NP_215751.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)trehalose ABC transporter substrate-binding lipoprotein LpqY
MTBC0 PGAP re-annotationtrehalose ABC transporter substrate-binding protein LpqY
Revised (this work)Trehalose ABC transporter substrate-binding protein LpqY. Pfam: SBP_bac_1 (PF01547.31), SBP_bac_8 (PF13416.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGU9 SwissProt · reviewed · Evidence at protein level
UniProt nameTrehalose-binding lipoprotein LpqY
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. No binding affinity for maltose.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namelpqY
eggNOG descriptionExtracellular solute-binding protein
Orthologous groupCOG1653
KEGG orthology K02027
KEGG modules M00207
Gene Ontology (17) GO:0006810, GO:0008150, GO:0008643, GO:0009405, GO:0015766, GO:0015771, GO:0015772, GO:0040007, GO:0044110, GO:0044116, GO:0044117, GO:0044403 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.23 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBP_bac_1PF01547.31 2.0e-3342–373 Bacterial extracellular solute-binding protein
SBP_bac_8PF13416.12 3.6e-1650–404 Bacterial extracellular solute-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sugB (sugar ABC transporter permease SugB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1237 sugB sugar ABC transporter permease SugB 999 1000 ctx neighborhood:881 cooccurence:771 coexpression:451 experimental:997 textmining:902
Rv1236 sugA sugar ABC transporter permease SugA 999 996 ctx neighborhood:881 cooccurence:772 coexpression:453 experimental:788 textmining:936
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 999 995 ctx neighborhood:881 cooccurence:477 coexpression:469 experimental:870 textmining:964
Rv1234 transmembrane protein 855 855 ctx neighborhood:853
Rv2316 uspA sugar ABC transporter permease UspA 826 766 coexpression:428 experimental:412
Rv2317 uspB sugar ABC transporter permease UspB 831 759 coexpression:445 experimental:412
Rv2039c sugar ABC transporter permease 823 750 coexpression:446 experimental:412
Rv2040c sugar ABC transporter permease 758 744 coexpression:429 experimental:412
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 749 729 coexpression:426 experimental:412
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 774 721 coexpression:444 experimental:412
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 857 720 coexpression:465 experimental:469 textmining:513
Rv2038c ugpC sugar ABC transporter ATP-binding protein 817 720 coexpression:466 experimental:469
Rv1233c hyp hypothetical protein 508 509 ctx neighborhood:502
Rv1231c membrane protein 427 427 ctx neighborhood:423
Rv1232c hyp hypothetical protein 412 411 ctx neighborhood:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: trehalose ABC transporter substrate-binding lipoprotein LpqY
  • MTBC0 PGAP product: trehalose ABC transporter substrate-binding protein LpqY
  • Pfam (hmmscan --cut_ga): SBP_bac_1 PF01547.31 (E=2e-33), SBP_bac_8 PF13416.12 (E=4e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215751.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBP_bac_1 (PF01547.31), SBP_bac_8 (PF13416.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1653
  • Curated reference: UniProt P9WGU9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor sugB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001324|Rv1235|lpqY
MVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVVSFYTPATDGATFTAIAQRCNQQFGGRFTIAQVSLPRSPNEQRLQLARRLTGNDRTLDVMALDVVWTAEFAEAGWALPLSDDPAGLAENDAVADTLPGPLATAGWNHKLYAAPVTTNTQLLWYRPDLVNSPPTDWNAMIAEAARLHAAGEPSWIAVQANQGEGLVVWFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQILKSVATTPGADPSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRIPQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIGGLNLAVAKTTRHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQFQAKYPMHAIIRQQLTDAAVRPATPVYQALSIRLAAVLSPITEIDPESTADELAAQAQKAIDGMGLLP