lpqY Family assigned · medium auto-curated

H37Rv Rv1235 · MTBC0 mtbc0_001324 · 468 aa · 1385968–1387374 MTBC0 (+) · RefSeq NP_215751.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand tatB (Rv1224) — requalified: Sec-independent protein translocase protein TatB Rv1225c (Rv1225c) — family_assigned: HAD-IIA family hydrolase Rv1225c Rv1226c (Rv1226c) — family_assigned: PH domain-containing protein Rv1226c Rv1227c (Rv1227c) — family_assigned: PH domain-containing protein lpqX (Rv1228) — dark: hypothetical protein mrp (Rv1229c) — family_assigned: Mrp/NBP35 family ATP-binding protein mrp Rv1230c (Rv1230c) — family_assigned: lytic transglycosylase domain-containing protein Rv1230c Rv1231c (Rv1231c) — family_assigned: DUF1003 domain-containing protein Rv1232c (Rv1232c) — requalified: magnesium transporter Rv1232c Rv1233c (Rv1233c) — family_assigned: DUF4190 domain-containing protein Rv1234 (Rv1234) — requalified: general stress protein lpqY (Rv1235) — family_assigned: trehalose ABC transporter substrate-binding protein LpqY lpqY sugA (Rv1236) — family_assigned: trehalose ABC transporter permease SugA sugA sugB (Rv1237) — family_assigned: trehalose ABC transporter permease SugB sugB sugC (Rv1238) — family_assigned: trehalose ABC transporter ATP-binding protein SugC sugC corA (Rv1239c) — requalified: magnesium/cobalt transporter CorA corA mdh (Rv1240) — requalified: malate dehydrogenase mdh vapB33 (Rv1241) — requalified: type II toxin-antitoxin system antitoxin VapB33 vapC33 (Rv1242) — family_assigned: type II toxin-antitoxin system VapC family toxin lpqZ (Rv1244) — family_assigned: glycine betaine ABC transporter substrate-binding protein lpqZ Rv1245c (Rv1245c) — family_assigned: SDR family NAD(P)-dependent oxidoreductase Rv1245c relE (Rv1246c) — requalified: type II toxin-antitoxin system mRNA interferase RelE relB (Rv1247c) — family_assigned: type II toxin-antitoxin system Phd/YefM family antitoxin Rv1248c (Rv1248c) — family_assigned: multifunctional oxoglutarate decarboxylase/oxoglutarate dehy Rv1248c 1 376 kb 1 380 kb 1 384 kb 1 388 kb 1 392 kb 1 396 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)trehalose ABC transporter substrate-binding lipoprotein LpqY
MTBC0 PGAP re-annotationtrehalose ABC transporter substrate-binding protein LpqY
Revised (this work)Trehalose ABC transporter substrate-binding protein LpqY. Pfam: SBP_bac_1 (PF01547.31), SBP_bac_8 (PF13416.12).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 20 publications

20 TB publications mention this gene. 20 publication(s) discuss this gene (17 in a M. tuberculosis context, 6 in other mycobacteria — M. smegmatis (5)).

Most recent 5 of 20.
PublicationDate
Oligosaccharides from Scorzonera yildirimlii and S. zorkunensis, and their potential antimicrobial, enzyme inhibition, cytotoxic effect, and in silico study. doi:10.1016/j.carres.2026.109833 2026
Synthesis and evaluation of Trehalose-Pks13 inhibitor conjugates targeting mycobacteria. doi:10.1016/j.carres.2025.109506 2025
Improvement of 9α-hydroxyandrost-4-ene-3,17-dione production in Mycolicibacterium neoaurum by regulation of cell wall formation and transcriptional regulator PadR. doi:10.1016/j.jbiotec.2024.10.005 2024
Fluorinated trehalose analogues for cell surface engineering and imaging of Mycobacterium tuberculosis. doi:10.1039/d4sc00721b 2024
Proteomic Analysis of the Mycobacterium tuberculosis Outer Membrane for Potential Implications in Uptake of Small Molecules. doi:10.1021/acsinfecdis.3c00517 2024

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighboursugA (Rv1236, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.01 (95% CI -1.33 to 4.35). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionThought to be involved in active transport of sugar across the membrane (import).

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1267 · 100.0% identity
M. leprae ML1086 · 77.6% identity
M. marinum MMAR_4206 · 76.5% identity
M. smegmatis MSMEG_5061 · 69.8% identity
M. orygis RJtmp_001301 · 100.0% identity
M. abscessus MAB_1372 · 65.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WGU9 SwissProt · reviewed · Evidence at protein level
UniProt nameTrehalose-binding lipoprotein LpqY
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. No binding affinity for maltose.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namelpqY
eggNOG descriptionExtracellular solute-binding protein
Orthologous groupCOG1653
KEGG orthology K02027
KEGG modules M00207
Gene Ontology (17) GO:0006810, GO:0008150, GO:0008643, GO:0009405, GO:0015766, GO:0015771, GO:0015772, GO:0040007, GO:0044110, GO:0044116, GO:0044117, GO:0044403 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.23 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 78.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 49.3%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 30 in the ORF — 0 in the essential state, 0 growth-defect, 30 non-essential, 0 growth-advantage. Saturation 0.900, mean read count 50.1111111111. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness after prolonged in vitro passage (in vitro passage) -4.160.0 required
fitness in mouse infection (in vivo) -3.250.0 required
fitness in mouse infection (in vivo) -2.750.0 required
fitness in mouse infection (in vivo) -2.740.0058 required
fitness in mouse infection (in vivo) -2.670.0 required
fitness in mouse infection (in vivo) -2.650.0 required
fitness in mouse infection (in vivo) -2.590.0 required
fitness in mouse infection (in vivo) -2.580.024 required
fitness in mouse infection (in vivo) -2.520.025 required
fitness in mouse infection (in vivo) -2.400.0094 required
fitness in mouse infection (in vivo) -2.350.0048 required
fitness in mouse infection (in vivo) -2.320.016 required

Conditional fitness of transposon-disruption mutants across 39 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance60.2 ppm · rank 1631/3519 (53.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length468 aa
Molecular weight49.8 kDa
Theoretical pI5.46
GRAVY-0.004 (hydrophilic)
Aliphatic index90.4
Aromaticity0.071
Instability index39.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBP_bac_1PF01547.31 2.0e-3342–373 Bacterial extracellular solute-binding protein
SBP_bac_8PF13416.12 3.6e-1650–404 Bacterial extracellular solute-binding protein

Experimental structures (Protein Data Bank) 9 solved

PDBMethodResolutionCoverage
8ja8 X-ray diffraction 1.6 Å 100%
8jaa X-ray diffraction 1.7 Å 100%
8jab X-ray diffraction 1.7 Å 100%
7wda X-ray diffraction 1.91 Å 100%
8ja9 X-ray diffraction 2.1 Å 100%
8jac X-ray diffraction 2.1 Å 100%
7wcj X-ray diffraction 2.24 Å 100%
8jad X-ray diffraction 2.3 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (9 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.5

PDB hitprobTM-scoreE-valueDescription
7wda-assembly4_D 1.00 0.99 6.4e-70 sig 7wda-assembly4_D Crystal structure LpqY in complex with Trehalose from Mycobacterium tuberculosis
7wcj-assembly1_A 1.00 0.99 3.7e-70 sig 7wcj-assembly1_A Crystal structure LpqY from Mycobacterium tuberculosis
7wda-assembly3_C 1.00 0.99 1.8e-69 sig 7wda-assembly3_C Crystal structure LpqY in complex with Trehalose from Mycobacterium tuberculosis
7ape-assembly1_A 1.00 0.94 1.6e-61 sig 7ape-assembly1_A Crystal structure of LpqY from Mycobacterium thermoresistible in complex with trehalose
8hpn-assembly1_E 1.00 0.94 5.2e-54 sig 8hpn-assembly1_E LpqY-SugABC in state 3

Foldseek search of the AlphaFold DB model (mean pLDDT 92.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 5

Upstream (5' on genome)Rv1234 (+ strand, 20 bp gap)
Downstream (3' on genome)sugA (+ strand, -4 bp gap)
Predicted operon Rv1234 · lpqY · sugA · sugB · sugC

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv2011c (activates) · kstR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: sugB (sugar ABC transporter permease SugB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1237 sugB exp sugar ABC transporter permease SugB 999 1000 ctx neighborhood:881 cooccurence:771 coexpression:451 experimental:997 textmining:902
Rv1236 sugA exp sugar ABC transporter permease SugA 999 996 ctx neighborhood:881 cooccurence:772 coexpression:453 experimental:788 textmining:936
Rv1238 sugC exp sugar ABC transporter ATP-binding protein SugC 999 995 ctx neighborhood:881 cooccurence:477 coexpression:469 experimental:870 textmining:964
Rv1234 transmembrane protein 855 855 ctx neighborhood:853
Rv2316 uspA exp sugar ABC transporter permease UspA 826 766 coexpression:428 experimental:412
Rv2317 uspB exp sugar ABC transporter permease UspB 831 759 coexpression:445 experimental:412
Rv2039c exp sugar ABC transporter permease 823 750 coexpression:446 experimental:412
Rv2040c exp sugar ABC transporter permease 758 744 coexpression:429 experimental:412
Rv2835c ugpA exp sn-glycerol-3-phosphate ABC transporter permease UgpA 749 729 coexpression:426 experimental:412
Rv2834c ugpE exp sn-glycerol-3-phosphate ABC transporter permease UgpE 774 721 coexpression:444 experimental:412
Rv2832c ugpC exp sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 857 720 coexpression:465 experimental:469 textmining:513
Rv2038c ugpC exp sugar ABC transporter ATP-binding protein 817 720 coexpression:466 experimental:469
Rv1233c hyp hypothetical protein 508 509 ctx neighborhood:502
Rv1231c membrane protein 427 427 ctx neighborhood:423
Rv1232c hyp hypothetical protein 412 411 ctx neighborhood:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: trehalose ABC transporter substrate-binding lipoprotein LpqY
  • MTBC0 PGAP product: trehalose ABC transporter substrate-binding protein LpqY
  • Pfam (hmmscan --cut_ga): SBP_bac_1 PF01547.31 (E=2e-33), SBP_bac_8 PF13416.12 (E=4e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215751.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBP_bac_1 (PF01547.31), SBP_bac_8 (PF13416.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1653
  • Curated reference: UniProt P9WGU9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor sugB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001324|Rv1235|lpqY
MVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVVSFYTPATDGATFTAIAQRCNQQFGGRFTIAQVSLPRSPNEQRLQLARRLTGNDRTLDVMALDVVWTAEFAEAGWALPLSDDPAGLAENDAVADTLPGPLATAGWNHKLYAAPVTTNTQLLWYRPDLVNSPPTDWNAMIAEAARLHAAGEPSWIAVQANQGEGLVVWFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQILKSVATTPGADPSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRIPQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIGGLNLAVAKTTRHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQFQAKYPMHAIIRQQLTDAAVRPATPVYQALSIRLAAVLSPITEIDPESTADELAAQAQKAIDGMGLLP