raaS Family assigned · medium auto-curated

H37Rv Rv1219c · MTBC0 mtbc0_001307 · 212 aa · 1371165–1371803 (-) · RefSeq NP_215735.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationtranscriptional regulator RaaS
Revised (this work)Transcriptional regulator RaaS. Pfam: TetR_N (PF00440.30), TetR_C_25 (PF17933.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O86312 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulatory protein RaaS
Curated functionRegulates the expression of the Rv1217c-Rv1218c multidrug efflux system and its own expression. Acts by binding to promoter regions of Rv1219c and upstream of the Rv1218c gene. Important for survival in prolonged stationary phase and during macrophage infection. May be used to eliminate non-growing mycobacteria.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.285 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 7.6e-1412–57 Bacterial regulatory proteins, tetR family
TetR_C_25PF17933.7 3.0e-4589–192 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1217c (tetronasin ABC transporter integral membrane protein), high confidence from genomic context alone (score 919 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1217c tetronasin ABC transporter integral membrane protein 983 919 ctx neighborhood:881 textmining:800
Rv1218c tetronasin ABC transporter ATP-binding protein 981 908 ctx neighborhood:882 textmining:803
Rv1216c integral membrane protein 916 812 ctx neighborhood:801 textmining:573
Rv0677c mmpS5 membrane protein MmpS5 810 731 coexpression:731
Rv1215c hyp hypothetical protein 943 726 ctx neighborhood:725 textmining:803
Rv1220c methyltransferase 912 576 ctx neighborhood:574 textmining:803
Rv0523c hyp hypothetical protein 455 455 ctx cooccurence:452
Rv1214c PE14 PE family protein PE14 450 450 ctx neighborhood:444
Rv1014c pth peptidyl-tRNA hydrolase 400 401
Rv3050c AsnC family transcriptional regulator 663 335 textmining:514
Rv0676c mmpL5 transmembrane transport protein MmpL5 469 284
Rv2779c Lrp/AsnC family transcriptional regulator 679 89 textmining:663
Rv0452 transcriptional regulator 530 64 textmining:519
Rv0880 HTH-type transcriptional regulator 556 54 textmining:550
Rv3159c PPE53 PPE family protein PPE53 435 50 textmining:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: transcriptional regulator RaaS
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=8e-14), TetR_C_25 PF17933.7 (E=3e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215735.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_25 (PF17933.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O86312 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv1217c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001307|Rv1219c|raaS
MRSADLTAHARIREAAIEQFGRHGFGVGLRAIAEAAGVSAALVIHHFGSKEGLRKACDDFVAEEIRSSKAAALKSNDPTTWLAQMAEIESYAPLMAYLVRSMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAITGGGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRAMYEAFLAEAQQGEAHVG