furA Family assigned · medium auto-curated
H37Rv Rv1909c · MTBC0 mtbc0_002024 ·
147 aa ·
2174259–2174702 MTBC0
(-) ·
RefSeq NP_216425.2
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferric uptake regulation protein FurA |
|---|---|
| MTBC0 PGAP re-annotation | Fur family transcriptional regulator |
| Revised (this work) | Fur family transcriptional regulator. Pfam: FUR (PF01475.26). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 52 publications
52 TB publications mention this gene. 52 publication(s) discuss this gene (43 in a M. tuberculosis context, 21 in other mycobacteria — M. smegmatis (20), M. leprae (2), M. abscessus (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Linezolid-Induced Serotonin Release from QGP-1 Cells. doi:10.1055/a-2815-4097 | 2026 |
| Inactivation of cAMP receptor protein (MSMEG_6189) increases isoniazid susceptibility in Mycobacterium smegmatis via altered oxidative phosphorylation, elevated ROS production, and loss of ahpC expression. doi:10.1128/jb.00429-25 | 2025 |
| Coevolution of furA-Regulated Hyper-Inflammation and Mycobacterial Resistance to Oxidative Killing through Adaptation to Hydrogen Peroxide. doi:10.1128/spectrum.05367-22 | 2023 |
| Meddling with Metal Sensors: Fur-Family Proteins as Signaling Hubs. doi:10.1128/jb.00022-23 | 2023 |
| The H2O2 inherently released by the mycobacterial minor subpopulation enhances the survival of the major kin subpopulation against rifampicin. doi:10.1016/j.crmicr.2022.100148 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4/IdeR (whiB4 or ideR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.91 (95% CI -0.19 to 2.69). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Acts as a global negative controlling element, employing FE(2+) as a cofactor to bind the operator of the repressed genes. Seems to regulate transcription of KATG|Rv1908c gene. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1944c
· 99.3% identity |
|---|---|
| M. marinum |
MMAR_2915
· 76.1% identity |
| M. smegmatis |
MSMEG_6383
· 71.6% identity |
| M. orygis |
RJtmp_001981
· 99.3% identity |
| M. abscessus |
MAB_2471c
· 81.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WN87
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulator FurA |
| Curated function | Represses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | furA |
| eggNOG description | Belongs to the Fur family |
| Orthologous group | COG0735 |
| KEGG orthology |
K22297
|
| Gene Ontology (29) |
GO:0003674, GO:0003700, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009889, GO:0010035, GO:0010038, GO:0010039, GO:0010468, GO:0010556 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.533 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 78.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 64.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 0.909, mean read count 176.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -5.26 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.42 | 0.023 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 35.5 ppm · rank 1983/3519 (43.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 147 aa |
|---|---|
| Molecular weight | 15.9 kDa |
| Theoretical pI | 5.5 |
| GRAVY | -0.033 (hydrophilic) |
| Aliphatic index | 91.6 |
| Aromaticity | 0.054 |
| Instability index | 34.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FUR | PF01475.26 | 5.4e-18 | 14–110 | Ferric uptake regulator family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2w57-assembly1_B |
1.00 | 0.71 | 3.1e-09 sig | 2w57-assembly1_B Crystal structure of the Vibrio cholerae ferric uptake regulator (Fur) reveals structural rearrangement of the DNA-binding domains |
3f8n-assembly1_B |
1.00 | 0.75 | 1.3e-08 sig | 3f8n-assembly1_B Crystal structure of PerR-Zn-Mn |
1mzb-assembly1_A |
1.00 | 0.71 | 1.8e-08 sig | 1mzb-assembly1_A Ferric uptake regulator |
3eyy-assembly1_B |
1.00 | 0.72 | 1.5e-08 sig | 3eyy-assembly1_B Structural basis for the specialization of Nur, a nickel-specific Fur homologue, in metal sensing and DNA recognition |
6h1c-assembly1_B-2 |
1.00 | 0.74 | 2.7e-08 sig | 6h1c-assembly1_B-2 Structure of Ferric uptake regulator from Pseudomonas aeruginosa with manganese. |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | katG (- strand, 37 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1910c (- strand, 113 bp gap) |
| Predicted operon |
Rv1907c · katG · furA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
Rv0324 (activates) · Rv1353c (activates) · Rv2989 (activates) · Rv3488 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: katG (catalase-peroxidase), high confidence from genomic context alone (score 837 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1908c katG |
catalase-peroxidase | 979 | 837 ctx | neighborhood:829 textmining:879 |
Rv1907c hyp |
hypothetical protein | 831 | 712 ctx | neighborhood:698 textmining:438 |
Rv3457c rpoA exp |
DNA-directed RNA polymerase subunit alpha | 696 | 685 | experimental:652 |
Rv2428 ahpC |
alkyl hydroperoxide reductase subunit AhpC | 870 | 596 | coexpression:573 textmining:692 |
Rv1910c hyp |
hypothetical protein | 686 | 555 ctx | neighborhood:553 |
Rv2710 sigB exp |
RNA polymerase sigma factor SigB | 589 | 551 | experimental:420 |
Rv2703 sigA exp |
RNA polymerase sigma factor SigA | 587 | 548 | experimental:420 |
Rv0667 rpoB exp |
DNA-directed RNA polymerase subunit beta | 615 | 496 | experimental:446 |
Rv0668 rpoC exp |
DNA-directed RNA polymerase subunit beta' | 487 | 488 | experimental:446 |
Rv1460 sufR |
transcriptional regulator | 480 | 481 | coexpression:464 |
Rv2788 sirR |
transcriptional repressor SirR | 605 | 479 | coexpression:461 |
Rv1390 rpoZ exp |
DNA-directed RNA polymerase subunit omega | 489 | 470 | experimental:446 |
Rv2621c |
transcriptional regulator | 523 | 464 | coexpression:447 |
Rv2618 hyp |
hypothetical protein | 456 | 457 | coexpression:439 |
Rv2711 ideR |
iron-dependent repressor and activator IdeR | 672 | 439 | coexpression:420 textmining:439 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferric uptake regulation protein FurA
- MTBC0 PGAP product: Fur family transcriptional regulator
- Pfam (hmmscan --cut_ga): FUR PF01475.26 (E=5e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216425.2)
- Domains: Pfam-A via hmmscan --cut_ga — FUR (PF01475.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0735 - Curated reference: UniProt P9WN87 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
katG - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002024|Rv1909c|furA MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for furA? Email the maintainer — the message is pre-filled with this gene's details.