furA Family assigned · medium auto-curated

H37Rv Rv1909c · MTBC0 mtbc0_002024 · 147 aa · 2174259–2174702 (-) · RefSeq NP_216425.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferric uptake regulation protein FurA
MTBC0 PGAP re-annotationFur family transcriptional regulator
Revised (this work)Fur family transcriptional regulator. Pfam: FUR (PF01475.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN87 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator FurA
Curated functionRepresses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namefurA
eggNOG descriptionBelongs to the Fur family
Orthologous groupCOG0735
KEGG orthology K22297
Gene Ontology (29) GO:0003674, GO:0003700, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009889, GO:0010035, GO:0010038, GO:0010039, GO:0010468, GO:0010556 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.533 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FURPF01475.26 5.4e-1814–110 Ferric uptake regulator family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: katG (catalase-peroxidase), high confidence from genomic context alone (score 837 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1908c katG catalase-peroxidase 979 837 ctx neighborhood:829 textmining:879
Rv1907c hyp hypothetical protein 831 712 ctx neighborhood:698 textmining:438
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 696 685 experimental:652
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 870 596 coexpression:573 textmining:692
Rv1910c hyp hypothetical protein 686 555 ctx neighborhood:553
Rv2710 sigB RNA polymerase sigma factor SigB 589 551 experimental:420
Rv2703 sigA RNA polymerase sigma factor SigA 587 548 experimental:420
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 615 496 experimental:446
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 487 488 experimental:446
Rv1460 sufR transcriptional regulator 480 481 coexpression:464
Rv2788 sirR transcriptional repressor SirR 605 479 coexpression:461
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 489 470 experimental:446
Rv2621c transcriptional regulator 523 464 coexpression:447
Rv2618 hyp hypothetical protein 456 457 coexpression:439
Rv2711 ideR iron-dependent repressor and activator IdeR 672 439 coexpression:420 textmining:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferric uptake regulation protein FurA
  • MTBC0 PGAP product: Fur family transcriptional regulator
  • Pfam (hmmscan --cut_ga): FUR PF01475.26 (E=5e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216425.2)
  • Domains: Pfam-A via hmmscan --cut_ga — FUR (PF01475.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0735
  • Curated reference: UniProt P9WN87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor katG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002024|Rv1909c|furA
MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP