furA Family assigned · medium auto-curated
H37Rv Rv1909c · MTBC0 mtbc0_002024 ·
147 aa · 2174259–2174702 (-) ·
RefSeq NP_216425.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ferric uptake regulation protein FurA |
|---|---|
| MTBC0 PGAP re-annotation | Fur family transcriptional regulator |
| Revised (this work) | Fur family transcriptional regulator. Pfam: FUR (PF01475.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WN87
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulator FurA |
| Curated function | Represses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | furA |
| eggNOG description | Belongs to the Fur family |
| Orthologous group | COG0735 |
| KEGG orthology |
K22297
|
| Gene Ontology (29) |
GO:0003674, GO:0003700, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009889, GO:0010035, GO:0010038, GO:0010039, GO:0010468, GO:0010556 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.533 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FUR | PF01475.26 | 5.4e-18 | 14–110 | Ferric uptake regulator family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: katG (catalase-peroxidase), high confidence from genomic context alone (score 837 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1908c katG |
catalase-peroxidase | 979 | 837 ctx | neighborhood:829 textmining:879 |
Rv1907c hyp |
hypothetical protein | 831 | 712 ctx | neighborhood:698 textmining:438 |
Rv3457c rpoA |
DNA-directed RNA polymerase subunit alpha | 696 | 685 | experimental:652 |
Rv2428 ahpC |
alkyl hydroperoxide reductase subunit AhpC | 870 | 596 | coexpression:573 textmining:692 |
Rv1910c hyp |
hypothetical protein | 686 | 555 ctx | neighborhood:553 |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 589 | 551 | experimental:420 |
Rv2703 sigA |
RNA polymerase sigma factor SigA | 587 | 548 | experimental:420 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 615 | 496 | experimental:446 |
Rv0668 rpoC |
DNA-directed RNA polymerase subunit beta' | 487 | 488 | experimental:446 |
Rv1460 sufR |
transcriptional regulator | 480 | 481 | coexpression:464 |
Rv2788 sirR |
transcriptional repressor SirR | 605 | 479 | coexpression:461 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 489 | 470 | experimental:446 |
Rv2621c |
transcriptional regulator | 523 | 464 | coexpression:447 |
Rv2618 hyp |
hypothetical protein | 456 | 457 | coexpression:439 |
Rv2711 ideR |
iron-dependent repressor and activator IdeR | 672 | 439 | coexpression:420 textmining:439 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ferric uptake regulation protein FurA
- MTBC0 PGAP product: Fur family transcriptional regulator
- Pfam (hmmscan --cut_ga): FUR PF01475.26 (E=5e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216425.2)
- Domains: Pfam-A via hmmscan --cut_ga — FUR (PF01475.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0735 - Curated reference: UniProt P9WN87 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
katG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002024|Rv1909c|furA MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP