tpx Resolved · high auto-curated

H37Rv Rv1932 · MTBC0 mtbc0_002046 · 165 aa · 2202488–2202985 (+) · RefSeq NP_216448.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2-Cys peroxiredoxin
MTBC0 PGAP re-annotationthiol peroxidase
Revised (this work)Thiol peroxidase. Pfam: Redoxin (PF08534.17), AhpC-TSA (PF00578.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG35 SwissProt · reviewed · Evidence at protein level
UniProt nameThiol peroxidase
EC (curated) EC 1.11.1.24
Curated functionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nametpx
eggNOG descriptionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides
Orthologous groupCOG2077
EC number EC 1.11.1.15
KEGG orthology K11065
Gene Ontology (70) GO:0003674, GO:0003824, GO:0004601, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0006979 +58 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.772 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RedoxinPF08534.17 2.8e-3120–160 Redoxin
AhpC-TSAPF00578.28 1.8e-1620–143 AhpC/TSA family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1931c (transcriptional regulator), medium confidence from genomic context alone (score 636 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1930c hyp hypothetical protein 763 764 ctx neighborhood:764
Rv3846 sodA superoxide dismutase 885 728 coexpression:712 textmining:595
Rv1931c transcriptional regulator 636 636 ctx neighborhood:636
Rv1929c hyp hypothetical protein 513 513 ctx neighborhood:511
Rv1928c short-chain type dehydrogenase/reductase 465 465 ctx neighborhood:438
Rv3025c iscS cysteine desulfurase 459 460 coexpression:417
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 766 456 coexpression:426 textmining:589
Rv2711 ideR iron-dependent repressor and activator IdeR 476 448 coexpression:416
Rv2788 sirR transcriptional repressor SirR 475 446 coexpression:414
Rv2216 epimerase family protein 443 444 coexpression:444
Rv2903c lepB signal peptidase 439 440 coexpression:440
Rv0993 galU UTP--glucose-1-phosphate uridylyltransferase 437 438 coexpression:425
Rv2359 zur zinc uptake regulation protein 457 425 coexpression:423
Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX 491 424 coexpression:404
Rv1909c furA ferric uptake regulation protein FurA 456 424 coexpression:422

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2-Cys peroxiredoxin
  • MTBC0 PGAP product: thiol peroxidase
  • Pfam (hmmscan --cut_ga): Redoxin PF08534.17 (E=3e-31), AhpC-TSA PF00578.28 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216448.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Redoxin (PF08534.17), AhpC-TSA (PF00578.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2077
  • Curated reference: UniProt P9WG35 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor Rv1931c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002046|Rv1932|tpx
MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA