Rv0082 Family assigned · medium auto-curated

H37Rv Rv0082 · MTBC0 mtbc0_000092 · 159 aa · 90087–90566 (+) · RefSeq NP_214596.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationNADH-quinone oxidoreductase subunit B family protein
Revised (this work)NADH-quinone oxidoreductase subunit B family protein. Pfam: Oxidored_q6 (PF01058.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XUD2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namehycG
eggNOG descriptionoxidoreductase
Orthologous groupCOG3260

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.193 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Oxidored_q6PF01058.30 1.2e-2845–155 NADH ubiquinone oxidoreductase, 20 Kd subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hycE (formate hydrogenase HycE), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0087 hycE formate hydrogenase HycE 999 1000 ctx neighborhood:884 cooccurence:774 coexpression:926 experimental:999 textmining:835
Rv0084 hycD formate hydrogenlyase HycD 999 1000 ctx neighborhood:882 cooccurence:768 coexpression:844 experimental:899
Rv0083 oxidoreductase 999 999 ctx neighborhood:881 cooccurence:768 coexpression:884 experimental:784
Rv0086 hycQ hydrogenase HycQ 998 999 ctx neighborhood:874 cooccurence:770 coexpression:840 experimental:784
Rv0085 hycP hydrogenase HycP 994 994 ctx neighborhood:874 cooccurence:736 coexpression:824
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 986 983 ctx cooccurence:534 coexpression:633 experimental:896
Rv0081 HTH-type transcriptional regulator 985 975 ctx neighborhood:881 coexpression:800 textmining:433
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 730 730 ctx cooccurence:728
Rv0088 polyketide cyclase/dehydrase 656 656 ctx neighborhood:644
Rv0080 hyp hypothetical protein 841 558 ctx neighborhood:554 textmining:655
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 604 557 ctx cooccurence:518
Rv0079 hyp hypothetical protein 787 551 ctx neighborhood:548 textmining:547
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 612 549 ctx cooccurence:486
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 538 521 ctx cooccurence:499
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 512 512 ctx cooccurence:490

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: NADH-quinone oxidoreductase subunit B family protein
  • Pfam (hmmscan --cut_ga): Oxidored_q6 PF01058.30 (E=1e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214596.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q6 (PF01058.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3260
  • Curated reference: UniProt I6XUD2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor hycE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000092|Rv0082|
MGWVAKIFRVGRVVEPAAPLPAAIAEPPAGVRGSLQIRHVDAGSCNGCEVEISGAFGPVYDAERFGARLVASPRHADALLVTGVVTHNMAGPLRKTLEATPRPRVVIACGDCALNRGVFADAYGVVGAVGEVVPVDVEIAGCPPTPAAIMAALRSVTGK