Rv3256c Resolved · medium auto-curated

H37Rv Rv3256c · MTBC0 mtbc0_003464 · 346 aa · 3658418–3659458 (-) · RefSeq NP_217773.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTobH protein
Revised (this work)TobH protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05899 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1737
EC number EC 5.3.1.8, EC 5.3.1.9
KEGG orthology K15916
KEGG pathways map00010, map00030, map00051, map00500, map00520, map01100, map01110, map01120, map01130, map01200
KEGG modules M00001, M00004, M00114

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.416 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: manA (mannose-6-phosphate isomerase), high confidence from genomic context alone (score 945 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3255c manA mannose-6-phosphate isomerase 989 945 ctx neighborhood:881 coexpression:553 textmining:809
Rv3257c pmmA phosphomannomutase PmmA 902 896 ctx neighborhood:881
Rv2700 cei hyp hypothetical protein 751 751 ctx cooccurence:751
Rv2732c transmembrane protein 749 749 ctx cooccurence:740
Rv0556 transmembrane protein 747 748 ctx cooccurence:744
Rv0358 hyp hypothetical protein 746 747 ctx cooccurence:746
Rv3850 hyp hypothetical protein 740 740 ctx cooccurence:739
Rv2325c hyp hypothetical protein 738 739 coexpression:734
Rv3212 hyp hypothetical protein 732 732 ctx cooccurence:719
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 731 731 ctx cooccurence:720
Rv2446c integral membrane protein 729 730 ctx cooccurence:725
Rv3438 hyp hypothetical protein 723 723 ctx cooccurence:723
Rv3205c hyp hypothetical protein 719 719 ctx cooccurence:712
Rv0996 transmembrane protein 710 710 ctx cooccurence:707
Rv1109c hyp hypothetical protein 702 703 ctx cooccurence:701

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TobH protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217773.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1737
  • Curated reference: UniProt O05899 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 139 functional partner(s); context anchor manA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003464|Rv3256c|
MNVARAIDLEDTEGLIAADRGALLRAASMAGAQVRAIAAAADEGELDLLRGSDRPRSVIWVTGRGTAETAGTILASTLGAGAAEPIVLASAAPPWVGPLDVLIVAGDDPGDPALVGAAAIGVRRGARVVVVAPYEGPLRDSTAGRVAVLEPRLRVPDEFGLSRYLAAGLAALQTVDPKLRIDLASLADELDAEALRNSAGREVFTNPAKALAARVSGCQLALAGDNAATLALARHGSSVMLRIANQVVAATRLSDAVVALRAGTPPDALFHDEEIDGPAPQRLRVLALALAGERTVVAARVAGLDDAYLVAAEDVPELLDAPVGSGGAVLAVRLEMAAVYLRLVRG