Rv2036 Family assigned · medium auto-curated
H37Rv Rv2036 · MTBC0 mtbc0_002169 ·
213 aa · 2310712–2311353 (+) ·
RefSeq NP_216552.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | maleylpyruvate isomerase family mycothiol-dependent enzyme |
| Revised (this work) | Maleylpyruvate isomerase family mycothiol-dependent enzyme. Pfam: MDMPI_N (PF11716.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53480
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Mycothiol maleylpyruvate isomerase N-terminal domain |
| Orthologous group | 2AEJC |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.035 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MDMPI_N | PF11716.14 | 2.7e-10 | 17–62 | Mycothiol maleylpyruvate isomerase N-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), high confidence from genomic context alone (score 886 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2035 hyp |
hypothetical protein | 992 | 983 ctx | neighborhood:882 coexpression:845 textmining:546 |
Rv2034 |
ArsR family HTH-type transcriptional repressor | 893 | 886 ctx | neighborhood:882 |
Rv3791 dprE2 |
decaprenylphosphoryl-D-2-keto erythropentose reductase | 587 | 587 ctx | neighborhood:516 |
Rv3790 dprE1 |
decaprenylphosphoryl-beta-D-ribose oxidase | 577 | 578 ctx | neighborhood:500 |
Rv2570 hyp |
hypothetical protein | 561 | 562 ctx | cooccurence:559 |
Rv2033c hyp |
hypothetical protein | 769 | 548 ctx | neighborhood:546 textmining:511 |
Rv3792 aftA |
arabinofuranosyltransferase | 516 | 516 ctx | neighborhood:516 |
Rv3707c hyp |
hypothetical protein | 446 | 446 ctx | cooccurence:446 |
Rv1856c |
oxidoreductase | 420 | 420 ctx | cooccurence:420 |
Rv2622 |
methyltransferase | 518 | 55 | textmining:511 |
Rv2705c hyp |
hypothetical protein | 490 | 50 | textmining:486 |
Rv1775 hyp |
hypothetical protein | 805 | 44 | textmining:805 |
Rv2706c hyp |
hypothetical protein | 511 | 44 | textmining:510 |
Rv2704 hyp |
hypothetical protein | 511 | 44 | textmining:510 |
Rv1823 hyp |
hypothetical protein | 412 | 44 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: maleylpyruvate isomerase family mycothiol-dependent enzyme
- Pfam (hmmscan --cut_ga): MDMPI_N PF11716.14 (E=3e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216552.1)
- Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AEJC - Curated reference: UniProt O53480 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
Rv2034 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002169|Rv2036| MIAADDDTEKSMMDMARAERAELAAFLTTLTLQQWETPSLCAGWSVKEVVAHMISYEDLGVFGLLKRFAKGRIVRANEVGVDEFAGLSPQELVDYVGRHLQPRGLTAGFGGMIALVDGMIHHQDIRRPLGQPRTIPAQRLDRVLRLMPKNPRLRARPRIKGLRLRATDLDWTIGTGPEVTGPGEALLMAMAGRPAAVSDLSGPGKPTLAGRLG