Rv2036 Family assigned · medium auto-curated

H37Rv Rv2036 · MTBC0 mtbc0_002169 · 213 aa · 2310712–2311353 (+) · RefSeq NP_216552.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmaleylpyruvate isomerase family mycothiol-dependent enzyme
Revised (this work)Maleylpyruvate isomerase family mycothiol-dependent enzyme. Pfam: MDMPI_N (PF11716.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53480 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionMycothiol maleylpyruvate isomerase N-terminal domain
Orthologous group2AEJC

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.035 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MDMPI_NPF11716.14 2.7e-1017–62 Mycothiol maleylpyruvate isomerase N-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), high confidence from genomic context alone (score 886 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2035 hyp hypothetical protein 992 983 ctx neighborhood:882 coexpression:845 textmining:546
Rv2034 ArsR family HTH-type transcriptional repressor 893 886 ctx neighborhood:882
Rv3791 dprE2 decaprenylphosphoryl-D-2-keto erythropentose reductase 587 587 ctx neighborhood:516
Rv3790 dprE1 decaprenylphosphoryl-beta-D-ribose oxidase 577 578 ctx neighborhood:500
Rv2570 hyp hypothetical protein 561 562 ctx cooccurence:559
Rv2033c hyp hypothetical protein 769 548 ctx neighborhood:546 textmining:511
Rv3792 aftA arabinofuranosyltransferase 516 516 ctx neighborhood:516
Rv3707c hyp hypothetical protein 446 446 ctx cooccurence:446
Rv1856c oxidoreductase 420 420 ctx cooccurence:420
Rv2622 methyltransferase 518 55 textmining:511
Rv2705c hyp hypothetical protein 490 50 textmining:486
Rv1775 hyp hypothetical protein 805 44 textmining:805
Rv2706c hyp hypothetical protein 511 44 textmining:510
Rv2704 hyp hypothetical protein 511 44 textmining:510
Rv1823 hyp hypothetical protein 412 44 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: maleylpyruvate isomerase family mycothiol-dependent enzyme
  • Pfam (hmmscan --cut_ga): MDMPI_N PF11716.14 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216552.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MDMPI_N (PF11716.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AEJC
  • Curated reference: UniProt O53480 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv2034
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002169|Rv2036|
MIAADDDTEKSMMDMARAERAELAAFLTTLTLQQWETPSLCAGWSVKEVVAHMISYEDLGVFGLLKRFAKGRIVRANEVGVDEFAGLSPQELVDYVGRHLQPRGLTAGFGGMIALVDGMIHHQDIRRPLGQPRTIPAQRLDRVLRLMPKNPRLRARPRIKGLRLRATDLDWTIGTGPEVTGPGEALLMAMAGRPAAVSDLSGPGKPTLAGRLG