sigH Family assigned · medium auto-curated
H37Rv Rv3223c · MTBC0 mtbc0_003430 ·
216 aa ·
3621043–3621693 MTBC0
(-) ·
RefSeq NP_217739.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ECF RNA polymerase sigma factor SigH |
|---|---|
| MTBC0 PGAP re-annotation | sigma-70 family RNA polymerase sigma factor SigH |
| Revised (this work) | Sigma-70 family RNA polymerase sigma factor SigH. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 67 publications
67 TB publications mention this gene. 67 publication(s) discuss this gene (54 in a M. tuberculosis context, 21 in other mycobacteria — M. smegmatis (11), M. abscessus (7), M. marinum (2), M. leprae (1)).
| Publication | Date |
|---|---|
| The stress response factor SigH mediates intrinsic resistance to multiple antibiotics in Mycobacterium abscessus. doi:10.1128/spectrum.03965-25 | 2026 |
| Modular toolkit to facilitate molecular manipulations in mycobacteria. doi:10.1128/jb.00474-25 | 2026 |
| Physiological stage-dependent effects of Mycobacterium tuberculosis on human placental tissue: insights into early reactivation and immune modulation. doi:10.3389/fmicb.2025.1682405 | 2025 |
| Resilience to stress and antibiotics, coupled with immunomodulatory behavior, uncovers Mycobacterium indicus pranii as a suitable surrogate model for tuberculosis research. doi:10.1016/j.bbrc.2025.152296 | 2025 |
| Prevention of tuberculosis in cynomolgus macaques by an attenuated Mycobacterium tuberculosis vaccine candidate. doi:10.1038/s41467-025-57090-4 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 18% of residues (metapredict) · mean AlphaFold pLDDT 76.2 |
|---|---|
| Disordered regions | 2 IDR(s), longest 21 aa [0-21, 199-216] |
carries a substantial disordered region (38/216 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv3222c (Rv3222c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.46 (95% CI -1.23 to 3.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Alternative sigma factor that plays a role in the oxidative-stress response (regulation of thioredoxin recycling). The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. This sigma factor is involved in heat shock and oxidative stress response; it is believed to control protein processing in the extracytoplasmic co |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3250c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1334
· 91.7% identity |
| M. smegmatis |
MSMEG_1914
· 87.7% identity |
| M. orygis |
RJtmp_003323
· 100.0% identity |
| M. abscessus |
MAB_3543c
· 84.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGH9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ECF RNA polymerase sigma factor SigH |
| Curated function | Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor (RshA) until released. This sigma factor is involved in heat shock and oxidative stress responses; it positively regulates the expression of itself, sigE, sigB and a number of transcriptional regulators as well as other effectors of heat and oxidative stress, leading to direct and indirect control of up to 25% of the bacterial genome. Modulates expression o. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | sigH |
| eggNOG description | Belongs to the sigma-70 factor family. ECF subfamily |
| Orthologous group | COG1595 |
| KEGG orthology |
K03088
|
| Gene Ontology (45) |
GO:0000988, GO:0000990, GO:0003674, GO:0005575, GO:0005618, GO:0005623, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009266, GO:0009408 +33 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.63 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.063
· 13 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.063) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 87.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 69.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 127.933333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -3.42 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.64 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.75 | 0.013 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.62 | 0.0068 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.54 | 0.0 | disruption advantageous |
| altered fitness under 6 weeks hypoxia (stress) | -1.53 | 0.0 | required |
| fitness in mouse infection (in vivo) | +1.38 | 0.02 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.33 | 0.031 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.31 | 0.0063 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.29 | 0.025 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.25 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.23 | 0.042 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 16 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 241.0 ppm · rank 756/3519 (78.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 216 aa |
|---|---|
| Molecular weight | 24.2 kDa |
| Theoretical pI | 4.98 |
| GRAVY | -0.575 (hydrophilic) |
| Aliphatic index | 76.5 |
| Aromaticity | 0.079 |
| Instability index | 46.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Sigma70_r2 | PF04542.21 | 8.9e-18 | 37–99 | Sigma-70 region 2 |
Sigma70_r4_2 | PF08281.19 | 1.7e-16 | 140–191 | Sigma-70, region 4 |
Sigma70_r4 | PF04545.23 | 2.1e-10 | 144–192 | Sigma-70, region 4 |
Experimental structures (Protein Data Bank) 8 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5zx3 |
X-ray diffraction | 2.751 Å | 100% |
5zx2 |
X-ray diffraction | 2.8 Å | 100% |
6koo |
X-ray diffraction | 2.8 Å | 100% |
6jcx |
X-ray diffraction | 2.903 Å | 100% |
6kon |
X-ray diffraction | 3.0 Å | 100% |
6kop |
X-ray diffraction | 3.303 Å | 100% |
6koq |
X-ray diffraction | 3.353 Å | 100% |
6jcy |
X-ray diffraction | 3.106 Å | 77% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (8 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 76.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6kon-assembly1_F |
1.00 | 0.46 | 2.0e-18 sig | 6kon-assembly1_F Mycobacterium tuberculosis initial transcription complex comprising sigma H and 5'-OH RNA of 5 nt |
6kop-assembly1_F |
1.00 | 0.49 | 1.2e-16 sig | 6kop-assembly1_F Mycobacterium tuberculosis initial transcription complex comprising sigma H and 5'-OH RNA of 9 nt |
5zx3-assembly1_F |
1.00 | 0.44 | 2.5e-16 sig | 5zx3-assembly1_F Mycobacterium tuberculosis RNA polymerase holoenzyme with ECF sigma factor sigma H |
6koq-assembly1_F |
1.00 | 0.47 | 5.0e-14 sig | 6koq-assembly1_F Mycobacterium tuberculosis initial transcription complex comprising sigma H and 5'-OH RNA of 10 nt |
6jcy-assembly1_F |
1.00 | 0.49 | 2.0e-13 sig | 6jcy-assembly1_F Mycobacterium tuberculosis RNA polymerase transcription initiation open complex with a chimeric ECF sigma factor sigH/E |
Foldseek search of the AlphaFold DB model (mean pLDDT 76.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv3222c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3224 (+ strand, 299 bp gap) |
| Predicted operon |
rshA · Rv3222c · sigH
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulated by (1 TF) |
sigH (activates)
|
|---|---|
| Regulon | this transcription factor regulates 22 target gene(s) |
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rshA (anti-sigma factor RshA), high confidence from genomic context alone (score 983 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0667 rpoB exp |
DNA-directed RNA polymerase subunit beta | 999 | 999 | experimental:999 |
Rv0668 rpoC exp |
DNA-directed RNA polymerase subunit beta' | 999 | 999 | experimental:999 |
Rv3221A rshA exp |
anti-sigma factor RshA | 999 | 983 ctx | neighborhood:882 experimental:800 textmining:953 |
Rv3222c hyp |
hypothetical protein | 970 | 967 ctx | neighborhood:882 coexpression:732 |
Rv3457c rpoA exp |
DNA-directed RNA polymerase subunit alpha | 915 | 911 | experimental:898 |
Rv1390 rpoZ exp |
DNA-directed RNA polymerase subunit omega | 904 | 899 | experimental:898 |
Rv2069 sigC |
ECF RNA polymerase sigma factor SigC | 939 | 752 ctx | cooccurence:752 textmining:766 |
Rv3221c TB7.3 |
acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | 743 | 743 ctx | neighborhood:720 |
Rv3224 |
iron-regulated short-chain dehydrogenase/reductase | 722 | 723 ctx | neighborhood:717 |
Rv3224B |
Rv3224B, len: 72 aa. Conserved hypothetical protein (possibly gene fragment), similar to C-terminal part of ML0799|AL583919_131 conserved hy | 718 | 718 ctx | neighborhood:717 |
Rv3220c pdtaS |
two component sensor kinase | 599 | 578 ctx | neighborhood:508 |
Rv0014c pknB exp |
serine/threonine-protein kinase PknB | 843 | 565 | experimental:554 textmining:655 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 532 | 520 | coexpression:518 |
Rv0018c pstP exp |
phosphoserine/threonine phosphatase PstP | 528 | 516 | experimental:500 |
Rv3907c pcnA |
poly(A) polymerase PcnA | 523 | 506 ctx | cooccurence:492 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigH
- MTBC0 PGAP product: sigma-70 family RNA polymerase sigma factor SigH
- Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=9e-18), Sigma70_r4_2 PF08281.19 (E=2e-16), Sigma70_r4 PF04545.23 (E=2e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217739.1)
- Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1595 - Curated reference: UniProt P9WGH9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 76.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
61 functional partner(s); context anchor
rshA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003430|Rv3223c|sigH MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for sigH? Email the maintainer — the message is pre-filled with this gene's details.