sigH Family assigned · medium auto-curated

H37Rv Rv3223c · MTBC0 mtbc0_003430 · 216 aa · 3621043–3621693 (-) · RefSeq NP_217739.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ECF RNA polymerase sigma factor SigH
MTBC0 PGAP re-annotationsigma-70 family RNA polymerase sigma factor SigH
Revised (this work)Sigma-70 family RNA polymerase sigma factor SigH. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGH9 SwissProt · reviewed · Evidence at protein level
UniProt nameECF RNA polymerase sigma factor SigH
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor (RshA) until released. This sigma factor is involved in heat shock and oxidative stress responses; it positively regulates the expression of itself, sigE, sigB and a number of transcriptional regulators as well as other effectors of heat and oxidative stress, leading to direct and indirect control of up to 25% of the bacterial genome. Modulates expression o.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigH
eggNOG descriptionBelongs to the sigma-70 factor family. ECF subfamily
Orthologous groupCOG1595
KEGG orthology K03088
Gene Ontology (45) GO:0000988, GO:0000990, GO:0003674, GO:0005575, GO:0005618, GO:0005623, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009266, GO:0009408 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.63 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 8.9e-1837–99 Sigma-70 region 2
Sigma70_r4_2PF08281.19 1.7e-16140–191 Sigma-70, region 4
Sigma70_r4PF04545.23 2.1e-10144–192 Sigma-70, region 4

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rshA (anti-sigma factor RshA), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 999 999 experimental:999
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 999 999 experimental:999
Rv3221A rshA anti-sigma factor RshA 999 983 ctx neighborhood:882 experimental:800 textmining:953
Rv3222c hyp hypothetical protein 970 967 ctx neighborhood:882 coexpression:732
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 915 911 experimental:898
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 904 899 experimental:898
Rv2069 sigC ECF RNA polymerase sigma factor SigC 939 752 ctx cooccurence:752 textmining:766
Rv3221c TB7.3 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 743 743 ctx neighborhood:720
Rv3224 iron-regulated short-chain dehydrogenase/reductase 722 723 ctx neighborhood:717
Rv3224B Rv3224B, len: 72 aa. Conserved hypothetical protein (possibly gene fragment), similar to C-terminal part of ML0799|AL583919_131 conserved hy 718 718 ctx neighborhood:717
Rv3220c pdtaS two component sensor kinase 599 578 ctx neighborhood:508
Rv0014c pknB serine/threonine-protein kinase PknB 843 565 experimental:554 textmining:655
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 532 520 coexpression:518
Rv0018c pstP phosphoserine/threonine phosphatase PstP 528 516 experimental:500
Rv3907c pcnA poly(A) polymerase PcnA 523 506 ctx cooccurence:492

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigH
  • MTBC0 PGAP product: sigma-70 family RNA polymerase sigma factor SigH
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=9e-18), Sigma70_r4_2 PF08281.19 (E=2e-16), Sigma70_r4 PF04545.23 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217739.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1595
  • Curated reference: UniProt P9WGH9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor rshA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003430|Rv3223c|sigH
MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS