ceoC Resolved · high auto-curated

H37Rv Rv2692 · MTBC0 - · 220 aa · 3010024–3010686 (+) · RefSeq YP_177901.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)TRK system potassium uptake protein CeoC
MTBC0 PGAP re-annotation
Revised (this work)TRK system potassium uptake protein CeoC. Pfam: NAD_binding_7 (PF13241.13), F420_oxidored (PF03807.24), TrkA_N (PF02254.25), ApbA (PF02558.23), NAD_binding_10 (PF13460.13), TrkA_C (PF02080.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WFZ3 SwissProt · reviewed · Evidence at protein level
UniProt nameTrk system potassium uptake protein TrkA
Curated functionPart of a potassium transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameceoC
eggNOG descriptionTrk system potassium uptake protein
Orthologous groupCOG0569
KEGG orthology K03499
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NAD_binding_7PF13241.13 5.5e-062–87 Putative NAD(P)-binding
F420_oxidoredPF03807.24 2.3e-052–84 NADP oxidoreductase coenzyme F420-dependent
TrkA_NPF02254.25 2.2e-273–118 TrkA-N domain
ApbAPF02558.23 1.7e-053–39 Ketopantoate reductase PanE/ApbA
NAD_binding_10PF13460.13 1.5e-067–77 NAD(P)H-binding
TrkA_CPF02080.27 1.2e-11149–216 TrkA-C domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ceoB (TRK system potassium uptake protein CeoB), high confidence from genomic context alone (score 931 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2691 ceoB TRK system potassium uptake protein CeoB 951 931 ctx neighborhood:882
Rv2690c integral membrane protein 914 911 ctx neighborhood:741 cooccurence:665
Rv2694c hyp hypothetical protein 718 718 ctx cooccurence:717
Rv2689c hyp hypothetical protein 686 685 ctx neighborhood:684
Rv1407 fmu 16S rRNA m5C967 methyltransferase 672 672 coexpression:574
Rv0260c transcriptional regulator 592 583 coexpression:452
Rv0511 hemD uroporphyrin-III C-methyltransferase 480 480 coexpression:450
Rv3323c moaX MoaD-MoaE fusion protein MoaX 464 463 coexpression:458
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 461 462 coexpression:461
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 461 462 coexpression:461
Rv1631 coaE dephospho-CoA kinase CoaE 449 450 coexpression:418
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 400 213
Rv3237c hyp hypothetical protein 508 91 textmining:481
Rv3200c transmembrane cation transporter 482 47 textmining:479

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): TRK system potassium uptake protein CeoC
  • Pfam (hmmscan --cut_ga): NAD_binding_7 PF13241.13 (E=5e-06), F420_oxidored PF03807.24 (E=2e-05), TrkA_N PF02254.25 (E=2e-27), ApbA PF02558.23 (E=2e-05), NAD_binding_10 PF13460.13 (E=2e-06), TrkA_C PF02080.27 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177901.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_7 (PF13241.13), F420_oxidored (PF03807.24), TrkA_N (PF02254.25), ApbA (PF02558.23), NAD_binding_10 (PF13460.13), TrkA_C (PF02080.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0569
  • Curated reference: UniProt P9WFZ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor ceoB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2692|ceoC
MKVAVAGAGAVGRSVTRELVENGHDITLIERNPDHLDAAAIPEAHWRLGDACELSLLESIHLEEFDVVVAATGDDKVNVVLSLLAKTEFAVPRVVARVNDPRNEWLFNDAWGVDVAVSTPRMLASLIEEAVTIGDLVRLMEFRTGQANLVEITLPDNTPWGGKPVRKLQLPRDAALVTILRGPRVIVPEADEPLEGGDELLFVAVTEAEEELSRLLLPSM