Rv0854 Family assigned · medium auto-curated

H37Rv Rv0854 · MTBC0 mtbc0_000909 · 147 aa · 954334–954777 (+) · RefSeq NP_215369.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSRPBCC family protein
Revised (this work)SRPBCC family protein. Pfam: Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X9Y7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptioncyclase dehydrase
Orthologous groupCOG3832

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Polyketide_cyc2PF10604.16 8.7e-206–139 Polyketide cyclase / dehydrase and lipid transport
Polyketide_cycPF03364.26 1.1e-1611–137 Polyketide cyclase / dehydrase and lipid transport

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: far (fatty-acid-CoA racemase), high confidence from genomic context alone (score 823 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0855 far fatty-acid-CoA racemase 822 823 ctx neighborhood:817
Rv0474 HTH-type transcriptional regulator 763 755 ctx cooccurence:754
Rv3197 ABC transporter ATP-binding protein 718 705 ctx cooccurence:639
Rv3679 anion transporter ATPase 697 697 ctx cooccurence:686
Rv0487 hyp hypothetical protein 691 691 ctx cooccurence:691
Rv0502 hyp hypothetical protein 677 678 ctx cooccurence:675
Rv0164 TB18.5 hyp hypothetical protein 658 659 ctx cooccurence:655
Rv0853c pdc alpha-keto-acid decarboxylase 624 624 ctx neighborhood:618
Rv3680 anion transporter ATPase 605 605 ctx cooccurence:591
Rv0856 hyp hypothetical protein 596 596 ctx neighborhood:571
Rv0876c transmembrane protein 583 583 ctx cooccurence:583
Rv0857 hyp hypothetical protein 561 560 ctx neighborhood:516
Rv3916c hyp hypothetical protein 558 558 ctx cooccurence:558
Rv0501 galE2 UDP-glucose 4-epimerase GalE 536 536 ctx cooccurence:536
Rv2974c hyp hypothetical protein 515 515 ctx cooccurence:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SRPBCC family protein
  • Pfam (hmmscan --cut_ga): Polyketide_cyc2 PF10604.16 (E=9e-20), Polyketide_cyc PF03364.26 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215369.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3832
  • Curated reference: UniProt I6X9Y7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor far
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000909|Rv0854|
MAIKESRDIVIEASPEEILDVIADFEAMTEWSPAHQSVEILETGDDGRPSKVKMKVKTAGITDEQVVAYSWTDRSVRWTLVSSTQQRSQDGKYELTPKGDNTLVQFEITVDPQVPLPGFVLKRAIKGTIDTATEALRSQVLKVKKGQ