Rv1929c Family assigned · low auto-curated

H37Rv Rv1929c · MTBC0 mtbc0_002043 · 214 aa · 2200378–2201022 (-) · RefSeq NP_216445.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR03085 family metal-binding protein
Revised (this work)TIGR03085 family metal-binding protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95285 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTIGR03085 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionmolybdopterin cofactor binding
Orthologous groupCOG0243

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.071 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.67% of strains (967) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gltB (glutamate synthase large subunit), high confidence from genomic context alone (score 763 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0685 tuf elongation factor Tu 784 770 experimental:761
Rv1930c hyp hypothetical protein 770 770 ctx neighborhood:770
Rv3859c gltB glutamate synthase large subunit 871 763 ctx neighborhood:535 experimental:420 textmining:481
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 781 761 experimental:690
Rv1931c transcriptional regulator 757 757 ctx neighborhood:755
Rv1928c short-chain type dehydrogenase/reductase 658 656 ctx neighborhood:645
Rv1932 tpx 2-Cys peroxiredoxin 513 513 ctx neighborhood:511
Rv2239c hyp hypothetical protein 505 505 ctx cooccurence:502
Rv2375 hyp hypothetical protein 499 499 ctx cooccurence:499
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 539 496 experimental:465
Rv2181 alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase 475 476 ctx cooccurence:473
Rv3015c hyp hypothetical protein 447 448 ctx cooccurence:443
Rv2694c hyp hypothetical protein 471 446 ctx cooccurence:440
Rv1162 narH nitrate reductase subunit beta 489 441 experimental:420
Rv1913 hyp hypothetical protein 417 416 ctx cooccurence:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TIGR03085 family metal-binding protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216445.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0243
  • Curated reference: UniProt P95285 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor gltB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002043|Rv1929c|
MADVPLDAQERLELCDLLEELGPAVATLIEGWTAHDLAAHIVLRERDLVAGLCIVLPGPFQRFAERRRARLAQSKDFTWLVARIRSGPPMGFFRIGWVRTLANLNEFFVHHEDVRRASGRGPRSLTPEMDAALWRNVRRGSHFLSRRLHGCGLEIEWVGTGKRVRVRSGEPTARLTGPPGELLLYVFGRRAVARVEVSGPLEAIAAVHRTHFGM