Rv3013 Family assigned · low auto-curated

H37Rv Rv3013 · MTBC0 mtbc0_003202 · 218 aa · 3393124–3393780 (+) · RefSeq NP_217529.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationamino acid-binding protein
Revised (this work)Amino acid-binding protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53260 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
T Signal transduction mechanisms
eggNOG descriptionAmino acid-binding
Orthologous groupCOG0317

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3458c rpsD 30S ribosomal protein S4 849 842 experimental:812
Rv0704 rplB 50S ribosomal protein L2 836 836 experimental:812
Rv1298 rpmE 50S ribosomal protein L31 844 835 experimental:791
Rv2785c rpsO 30S ribosomal protein S15 832 832 experimental:826
Rv0723 rplO 50S ribosomal protein L15 831 831 experimental:826
Rv0721 rpsE 30S ribosomal protein S5 840 830 experimental:812
Rv0719 rplF 50S ribosomal protein L6 837 829 experimental:828
Rv0716 rplE 50S ribosomal protein L5 826 827 experimental:826
Rv0710 rpsQ 30S ribosomal protein S17 826 827 experimental:826
Rv1643 rplT 50S ribosomal protein L20 833 826 experimental:812
Rv0715 rplX 50S ribosomal protein L24 820 821 experimental:812
Rv3442c rpsI 30S ribosomal protein S9 832 820 experimental:812
Rv0053 rpsF 30S ribosomal protein S6 826 820 experimental:812
Rv2909c rpsP 30S ribosomal protein S16 819 820 experimental:812
Rv3443c rplM 50S ribosomal protein L13 829 819 experimental:812

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: amino acid-binding protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217529.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0317
  • Curated reference: UniProt O53260 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 149 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003202|Rv3013|
MRSYLLRIELADRPGSLGSLAVALGSVGADILSLDVVERGNGYAIDDLVVELPPGAMPDTLITAAEALNGVRVDSVRPHTGLLEAHRELELLDHVAAAEGATARLQVLVNEAPRVLRVSWCTVLRSSGGELHRLAGSPGAPETRANSAPWLPIERAAALDGGADWVPQAWRDMDTTMVAAPLGDTHTAVVLGRPGPEFRPSEVARLGYLAGIVATMLR