htpX Resolved · high auto-curated

H37Rv Rv0563 · MTBC0 mtbc0_000592 · 286 aa · 657430–658290 (+) · RefSeq NP_215077.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)protease HtpX
MTBC0 PGAP re-annotationzinc metalloprotease HtpX
Revised (this work)Zinc metalloprotease HtpX. Pfam: Peptidase_M48 (PF01435.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHS5 SwissProt · reviewed · Evidence at protein level
UniProt nameProtease HtpX homolog
EC (curated) EC 3.4.24.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namehtpX
eggNOG descriptionBelongs to the peptidase M48B family
Orthologous groupCOG0501
KEGG orthology K03799
KEGG modules M00743
Gene Ontology (13) GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0044425, GO:0044459, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.457 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_M48PF01435.25 1.0e-3670–283 Peptidase family M48

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: menJ (oxidoreductase), high confidence from genomic context alone (score 715 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2744c 35kd_ag hyp hypothetical protein 821 822 coexpression:816
Rv3837c phosphoglycerate mutase 811 812 coexpression:806
Rv0983 pepD serine protease PepD 819 810 coexpression:804
Rv2694c hyp hypothetical protein 730 730 coexpression:730
Rv0561c menJ oxidoreductase 715 715 ctx neighborhood:714
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 653 654 coexpression:651
Rv0342 iniA isoniazid inductible protein IniA 666 647 database:643
Rv0562 grcC1 polyprenyl-diphosphate synthase GrcC 646 632 ctx neighborhood:581
Rv2710 sigB RNA polymerase sigma factor SigB 640 618 coexpression:615
Rv3610c ftsH zinc metalloprotease FtsH 788 544 coexpression:475 textmining:555
Rv2373c dnaJ2 chaperone protein DnaJ 591 527
Rv2053c fxsA transmembrane protein FxsA 511 491 coexpression:491
Rv0351 grpE stress response protein GrpE 786 451 coexpression:433 textmining:627
Rv1285 cysD sulfate adenylyltransferase subunit 2 572 429 coexpression:429
Rv1286 cysC adenylyl-sulfate kinase 416 416 coexpression:416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: protease HtpX
  • MTBC0 PGAP product: zinc metalloprotease HtpX
  • Pfam (hmmscan --cut_ga): Peptidase_M48 PF01435.25 (E=1e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215077.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_M48 (PF01435.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0501
  • Curated reference: UniProt P9WHS5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor menJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000592|Rv0563|htpX
MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG