htpX Resolved · high auto-curated
H37Rv Rv0563 · MTBC0 mtbc0_000592 ·
286 aa ·
657430–658290 MTBC0
(+) ·
RefSeq NP_215077.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | protease HtpX |
|---|---|
| MTBC0 PGAP re-annotation | zinc metalloprotease HtpX |
| Revised (this work) | Zinc metalloprotease HtpX. Pfam: Peptidase_M48 (PF01435.25). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Mining the Mycobacterium tuberculosis proteome for identification of potential T-cell epitope based vaccine candidates. doi:10.1016/j.micpath.2021.104996 | 2021 |
| Mycobacterium tuberculosis Rv1152 is a Novel GntR Family Transcriptional Regulator Involved in Intrinsic Vancomycin Resistance and is a Potential Vancomycin Adjuvant Target. doi:10.1038/srep28002 | 2016 |
| Intranasal delivery of DNA encoding antigens of Mycobacterium tuberculosis by non-pathogenic invasive Escherichia coli. doi:10.1016/j.vaccine.2008.02.023 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Rv1776c+WhiB4 (Rv1776c and whiB4 ).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.48 (95% CI -1.96 to 4.37). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly involved in adaptation. Hydrolizes specific peptides and/or proteins. |
|---|---|
| Mycobrowser EC |
3.4.24.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0578
· 100.0% identity |
|---|---|
| M. leprae |
ML2278
· 88.5% identity |
| M. marinum |
MMAR_0912
· 94.8% identity |
| M. smegmatis |
MSMEG_1134
· 85.9% identity |
| M. orygis |
RJtmp_000591
· 100.0% identity |
| M. abscessus |
MAB_3927c
· 80.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHS5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Protease HtpX homolog |
| EC (curated) |
EC 3.4.24.-
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | htpX |
| eggNOG description | Belongs to the peptidase M48B family |
| Orthologous group | COG0501 |
| KEGG orthology |
K03799
|
| KEGG modules |
M00743
|
| Gene Ontology (13) |
GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0044425, GO:0044459, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.457 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 90.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 65.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 77.9090909091. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Ethambutol (drug exposure) | +3.74 | 0.0 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -3.35 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | -3.08 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.66 | 0.0 | disruption advantageous |
| altered fitness under high iron concentrations (stress) | -2.34 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.32 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.09 | 0.0055 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | -2.02 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 8 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 50.2 ppm · rank 1749/3519 (50.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (4 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 4 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 286 aa |
|---|---|
| Molecular weight | 30.7 kDa |
| Theoretical pI | 9.93 |
| GRAVY | 0.304 (hydrophobic) |
| Aliphatic index | 104.9 |
| Aromaticity | 0.059 |
| Instability index | 36.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Peptidase_M48 | PF01435.25 | 1.0e-36 | 70–283 | Peptidase family M48 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3cqb-assembly1_B |
1.00 | 0.82 | 4.9e-04 sig | 3cqb-assembly1_B Crystal structure of heat shock protein HtpX domain from Vibrio parahaemolyticus RIMD 2210633 |
3cqb-assembly1_A |
1.00 | 0.90 | 3.9e-03 sig | 3cqb-assembly1_A Crystal structure of heat shock protein HtpX domain from Vibrio parahaemolyticus RIMD 2210633 |
2ypt-assembly4_E |
1.00 | 0.48 | 5.4e-05 sig | 2ypt-assembly4_E Crystal structure of the human nuclear membrane zinc metalloprotease ZMPSTE24 mutant (E336A) in complex with a synthetic CSIM tetrapeptide from the C-terminus of prelamin A |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | grcC1 (+ strand, 100 bp gap) |
|---|---|
| Downstream (3' on genome) | gpdA1 (- strand, 184 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: menJ (oxidoreductase), high confidence from genomic context alone (score 715 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2744c 35kd_ag hyp |
hypothetical protein | 821 | 822 | coexpression:816 |
Rv3837c |
phosphoglycerate mutase | 811 | 812 | coexpression:806 |
Rv0983 pepD |
serine protease PepD | 819 | 810 | coexpression:804 |
Rv2694c hyp |
hypothetical protein | 730 | 730 | coexpression:730 |
Rv0561c menJ |
oxidoreductase | 715 | 715 ctx | neighborhood:714 |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 653 | 654 | coexpression:651 |
Rv0342 iniA exp |
isoniazid inductible protein IniA | 666 | 647 | database:643 |
Rv0562 grcC1 |
polyprenyl-diphosphate synthase GrcC | 646 | 632 ctx | neighborhood:581 |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 640 | 618 | coexpression:615 |
Rv3610c ftsH |
zinc metalloprotease FtsH | 788 | 544 | coexpression:475 textmining:555 |
Rv2373c dnaJ2 |
chaperone protein DnaJ | 591 | 527 | |
Rv2053c fxsA |
transmembrane protein FxsA | 511 | 491 | coexpression:491 |
Rv0351 grpE |
stress response protein GrpE | 786 | 451 | coexpression:433 textmining:627 |
Rv1285 cysD |
sulfate adenylyltransferase subunit 2 | 572 | 429 | coexpression:429 |
Rv1286 cysC |
adenylyl-sulfate kinase | 416 | 416 | coexpression:416 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: protease HtpX
- MTBC0 PGAP product: zinc metalloprotease HtpX
- Pfam (hmmscan --cut_ga): Peptidase_M48 PF01435.25 (E=1e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215077.1)
- Domains: Pfam-A via hmmscan --cut_ga — Peptidase_M48 (PF01435.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0501 - Curated reference: UniProt P9WHS5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
menJ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000592|Rv0563|htpX MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for htpX? Email the maintainer — the message is pre-filled with this gene's details.