sepH Resolved · medium auto-curated
H37Rv Rv0883c · MTBC0 mtbc0_000938 ·
253 aa · 983720–984481 (-) ·
RefSeq NP_215398.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | septation protein SepH |
| Revised (this work) | Septation protein SepH. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKQ7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0883c |
UniProt still lists this protein as Uncharacterized protein Rv0883c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF3071) |
| Orthologous group | 28PUQ |
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.072 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3071 | PF11268.14 | 1.1e-62 | 1–171 | Protein of unknown function (DUF3071) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: serC (phosphoserine aminotransferase), high confidence from genomic context alone (score 752 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0884c serC |
phosphoserine aminotransferase | 751 | 752 ctx | neighborhood:749 |
Rv0885 hyp |
hypothetical protein | 678 | 678 ctx | neighborhood:677 |
Rv0886 fprB |
ferredoxin/ferredoxin--NADP reductase | 669 | 670 ctx | neighborhood:670 |
Rv1002c pmt |
dolichyl-phosphate-mannose--protein mannosyltransferase | 619 | 619 ctx | cooccurence:617 |
Rv3212 hyp |
hypothetical protein | 577 | 577 ctx | cooccurence:573 |
Rv2413c hyp |
hypothetical protein | 565 | 566 ctx | cooccurence:563 |
Rv2256c hyp |
hypothetical protein | 557 | 557 ctx | cooccurence:553 |
Rv3311 hyp |
hypothetical protein | 538 | 539 ctx | cooccurence:528 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 549 | 532 ctx | cooccurence:529 |
Rv2772c |
transmembrane protein | 528 | 529 ctx | cooccurence:525 |
Rv2146c |
transmembrane protein | 527 | 528 ctx | cooccurence:511 |
Rv2680 hyp |
hypothetical protein | 526 | 526 ctx | cooccurence:513 |
Rv1364c |
sigma factor regulatory protein | 522 | 518 | coexpression:503 |
Rv2219 |
transmembrane protein | 576 | 512 ctx | cooccurence:509 |
Rv2169c |
transmembrane protein | 506 | 506 ctx | cooccurence:503 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: septation protein SepH
- Pfam (hmmscan --cut_ga): DUF3071 PF11268.14 (E=1e-62)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215398.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3071 (PF11268.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28PUQ - Curated reference: UniProt P9WKQ7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
73 functional partner(s); context anchor
serC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000938|Rv0883c|sepH MRELKVVGLDADGKNIICQGAIPSEQFKLPVDDRLRAALRDDSVQPEQAQLDIEVTNVLSPKEIQARIRAGASVEQVAAASGSDIARIRRFAHPVLLERSRAAELATAAHPVLADGPAVLTMQETVAAALVARGLNPDSLTWDAWRNEDSRWTVQLAWKAGRSDNLAHFRFTPGAHGGTATAIDDTAHELINPTFNRPLRPLAPVAHLDFDEPEPAQPTLTVPSAQPVSNRRGKPAIPAWEDVLLGVRSGGRR