Rv0508 Family assigned · medium auto-curated
H37Rv Rv0508 · MTBC0 mtbc0_000536 ·
97 aa · 603555–603848 (+) ·
RefSeq NP_215022.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | glutaredoxin family protein |
| Revised (this work) | Glutaredoxin family protein. Pfam: Glrx-like (PF05768.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKS9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0508 |
UniProt still lists this protein as Uncharacterized protein Rv0508; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| eggNOG description | Glutaredoxin-like domain (DUF836) |
| Orthologous group | COG0695 |
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glrx-like | PF05768.21 | 3.4e-20 | 5–83 | Glutaredoxin-like domain (DUF836) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mmpS2 (membrane protein MmpS2), high confidence from genomic context alone (score 879 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0506 mmpS2 |
membrane protein MmpS2 | 879 | 879 ctx | neighborhood:878 |
Rv0507 mmpL2 |
transmembrane transport protein MmpL2 | 867 | 867 ctx | neighborhood:866 |
Rv3051c nrdE |
ribonucleoside-diphosphate reductase subunit alpha | 863 | 851 | database:614 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 863 | 851 | database:614 |
Rv0509 hemA |
glutamyl-tRNA reductase | 818 | 812 ctx | neighborhood:811 |
Rv0510 hemC |
porphobilinogen deaminase | 809 | 809 ctx | neighborhood:808 |
Rv0505c serB1 |
phosphoserine phosphatase SerB | 803 | 804 ctx | neighborhood:766 |
Rv0511 hemD |
uroporphyrin-III C-methyltransferase | 790 | 777 ctx | neighborhood:773 |
Rv0512 hemB |
delta-aminolevulinic acid dehydratase | 712 | 712 ctx | neighborhood:708 |
Rv0513 |
transmembrane protein | 682 | 682 ctx | neighborhood:680 |
Rv0514 |
transmembrane protein | 660 | 660 ctx | neighborhood:655 |
Rv0038 hyp |
hypothetical protein | 643 | 643 | database:643 |
Rv0137c msrA |
peptide methionine sulfoxide reductase MsrA | 558 | 512 | experimental:484 |
Rv2468c hyp |
hypothetical protein | 473 | 474 ctx | cooccurence:466 |
Rv2693c |
integral membrane protein | 490 | 471 ctx | cooccurence:435 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: glutaredoxin family protein
- Pfam (hmmscan --cut_ga): Glrx-like PF05768.21 (E=3e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215022.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glrx-like (PF05768.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0695 - Curated reference: UniProt P9WKS9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
mmpS2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000536|Rv0508| MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP