Rv0508 Family assigned · medium auto-curated

H37Rv Rv0508 · MTBC0 mtbc0_000536 · 97 aa · 603555–603848 (+) · RefSeq NP_215022.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationglutaredoxin family protein
Revised (this work)Glutaredoxin family protein. Pfam: Glrx-like (PF05768.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKS9 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0508

UniProt still lists this protein as Uncharacterized protein Rv0508; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionGlutaredoxin-like domain (DUF836)
Orthologous groupCOG0695
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glrx-likePF05768.21 3.4e-205–83 Glutaredoxin-like domain (DUF836)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmpS2 (membrane protein MmpS2), high confidence from genomic context alone (score 879 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0506 mmpS2 membrane protein MmpS2 879 879 ctx neighborhood:878
Rv0507 mmpL2 transmembrane transport protein MmpL2 867 867 ctx neighborhood:866
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 863 851 database:614
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 863 851 database:614
Rv0509 hemA glutamyl-tRNA reductase 818 812 ctx neighborhood:811
Rv0510 hemC porphobilinogen deaminase 809 809 ctx neighborhood:808
Rv0505c serB1 phosphoserine phosphatase SerB 803 804 ctx neighborhood:766
Rv0511 hemD uroporphyrin-III C-methyltransferase 790 777 ctx neighborhood:773
Rv0512 hemB delta-aminolevulinic acid dehydratase 712 712 ctx neighborhood:708
Rv0513 transmembrane protein 682 682 ctx neighborhood:680
Rv0514 transmembrane protein 660 660 ctx neighborhood:655
Rv0038 hyp hypothetical protein 643 643 database:643
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 558 512 experimental:484
Rv2468c hyp hypothetical protein 473 474 ctx cooccurence:466
Rv2693c integral membrane protein 490 471 ctx cooccurence:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: glutaredoxin family protein
  • Pfam (hmmscan --cut_ga): Glrx-like PF05768.21 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215022.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glrx-like (PF05768.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0695
  • Curated reference: UniProt P9WKS9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor mmpS2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000536|Rv0508|
MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP