Rv1382 Resolved · high auto-curated

H37Rv Rv1382 · MTBC0 mtbc0_001483 · 165 aa · 1564821–1565318 (+) · RefSeq NP_215898.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtransporter
Revised (this work)Transporter. Pfam: bPH_11 (PF25362.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71810 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable export or membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
F Nucleotide transport and metabolism
eggNOG descriptionBelongs to the CarA family
Orthologous groupCOG0505

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_11PF25362.2 1.6e-4843–163 Bacterial PH domain-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: carB (carbamoyl-phosphate synthase large subunit), high confidence from genomic context alone (score 995 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1384 carB carbamoyl-phosphate synthase large subunit 996 995 ctx neighborhood:882 coexpression:793 experimental:829
Rv1381 pyrC dihydroorotase 994 994 ctx neighborhood:882 coexpression:953
Rv1383 carA carbamoyl-phosphate synthase small subunit 977 976 ctx neighborhood:882 coexpression:805
Rv1380 pyrB aspartate carbamoyltransferase 981 975 ctx neighborhood:882 coexpression:794
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 974 971 ctx neighborhood:881 coexpression:764
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 964 960 ctx neighborhood:882 coexpression:676
Rv2670c zapE hyp hypothetical protein 794 794 ctx cooccurence:770
Rv2772c transmembrane protein 774 774 ctx cooccurence:773
Rv3317 sdhD succinate dehydrogenase hydrophobic membrane anchor subunit 773 774 ctx cooccurence:771
Rv3316 sdhC succinate dehydrogenase cytochrome B-556 subunit 769 770 ctx cooccurence:768
Rv2139 pyrD dihydroorotate dehydrogenase 795 768 coexpression:729
Rv0383c ttfA hyp hypothetical protein 757 735 coexpression:668
Rv0385 monooxygenase 719 690 coexpression:676
Rv1937 oxygenase 784 685 coexpression:667
Rv0382c pyrE orotate phosphoribosyltransferase 707 681 coexpression:670

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: transporter
  • Pfam (hmmscan --cut_ga): bPH_11 PF25362.2 (E=2e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215898.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_11 (PF25362.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0505
  • Curated reference: UniProt P71810 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor carB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001483|Rv1382|
MNSGTLAGSLIFAAVLVMLIAVLARLMMRGWRRRSERQAELLGDLPDVPEHVSSATVTTRGLYVGATLSPAWNERVTVGDLGYRSKAVLTRYPSGIMVERARAQPIWIPTESIAAIRMERGVAGKVVAGIGILAIRWRLPSGTEIDVGFRADNRDEYQEWLEEPV