fbpB Resolved · high auto-curated
H37Rv Rv1886c · MTBC0 mtbc0_002000 ·
325 aa · 2152944–2153921 (-) ·
RefSeq NP_216402.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacylglycerol acyltransferase/mycolyltransferase Ag85B |
|---|---|
| MTBC0 PGAP re-annotation | diacylglycerol acyltransferase/mycolyltransferase Ag85B |
| Revised (this work) | Diacylglycerol acyltransferase/mycolyltransferase Ag85B. Pfam: Esterase (PF00756.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQP1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Diacylglycerol acyltransferase/mycolyltransferase Ag85B |
| EC (curated) |
EC 2.3.1.122, EC 2.3.1.20
|
| Curated function | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation o. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | fbpB |
| eggNOG description | fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM |
| Orthologous group | COG0627 |
| EC number |
EC 2.3.1.122, EC 2.3.1.20
|
| KEGG orthology |
K18851
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (70) |
GO:0001968, GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0009605 +58 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.31 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Esterase | PF00756.27 | 4.2e-74 | 55–318 | Putative esterase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1885c (chorismate mutase), high confidence from genomic context alone (score 941 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1885c |
chorismate mutase | 965 | 941 ctx | neighborhood:771 coexpression:754 textmining:435 |
Rv0129c fbpC |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 973 | 902 | database:900 textmining:738 |
Rv3804c fbpA |
diacylglycerol acyltransferase/mycolyltransferase Ag85A | 952 | 902 | database:900 textmining:530 |
Rv3097c lipY |
triacylglycerol lipase Lip | 904 | 901 | database:900 |
Rv2252 dagK |
diacylglycerol kinase | 900 | 901 | database:900 |
Rv0950c hyp |
hypothetical protein | 868 | 859 | coexpression:859 |
Rv3805c aftB |
terminal beta-(1->2)-arabinofuranosyltransferase | 790 | 790 ctx | cooccurence:541 database:500 |
Rv2190c ripC |
endopeptidase | 781 | 757 | coexpression:757 |
Rv3802c |
membrane protein | 756 | 749 ctx | cooccurence:715 |
Rv1884c rpfC |
resuscitation-promoting factor RpfC | 791 | 744 ctx | neighborhood:736 |
Rv1009 rpfB |
resuscitation-promoting factor RpfB | 843 | 733 | coexpression:733 textmining:437 |
Rv3668c |
protease | 731 | 692 ctx | cooccurence:691 |
Rv0412c glnX |
membrane protein | 665 | 652 ctx | cooccurence:420 coexpression:407 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 650 | 651 ctx | cooccurence:646 |
Rv3244c lpqB |
lipoprotein LpqB | 646 | 646 ctx | cooccurence:643 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacylglycerol acyltransferase/mycolyltransferase Ag85B
- MTBC0 PGAP product: diacylglycerol acyltransferase/mycolyltransferase Ag85B
- Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=4e-74)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216402.1)
- Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0627 - Curated reference: UniProt P9WQP1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
83 functional partner(s); context anchor
Rv1885c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002000|Rv1886c|fbpB MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG