Rv1898 Family assigned · medium auto-curated

H37Rv Rv1898 · MTBC0 mtbc0_002012 · 102 aa · 2163005–2163313 (+) · RefSeq NP_216414.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMTH1187 family thiamine-binding protein
Revised (this work)MTH1187 family thiamine-binding protein. Pfam: Thiamine_BP (PF01910.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFQ1 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0045 thiamine-binding protein family member Rv1898

UniProt still lists this protein as UPF0045 thiamine-binding protein family member Rv1898; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionThiamine-binding protein
Orthologous groupCOG0011
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thiamine_BPPF01910.23 4.3e-295–95 Thiamine-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dtd (D-tyrosyl-tRNA(Tyr) deacylase), high confidence from genomic context alone (score 787 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1897c dtd D-tyrosyl-tRNA(Tyr) deacylase 786 787 ctx neighborhood:787
Rv1896c S-adenosyl-L-methionine-dependent methyltransferase 609 609 ctx neighborhood:609
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 570 341
Rv2671 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase 500 156 textmining:432
Rv2672 protease 627 68 textmining:617
Rv0552 hyp hypothetical protein 808 67 textmining:803
Rv0874c hyp hypothetical protein 805 54 textmining:803
Rv0842 integral membrane protein 660 49 textmining:658
Rv2724c fadE20 acyl-CoA dehydrogenase FadE20 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MTH1187 family thiamine-binding protein
  • Pfam (hmmscan --cut_ga): Thiamine_BP PF01910.23 (E=4e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216414.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thiamine_BP (PF01910.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0011
  • Curated reference: UniProt P9WFQ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor dtd
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002012|Rv1898|
MSVLVAFSVTPLGVGEGVGEIVTEAIRVVRDSGLPNQTDAMFTVIEGDTWAEVMAVVQRAVEAVAARAPRVSAVIKVDWRPGVTDAMTQKVATVERYLLRPE