lppE Resolved · high auto-curated

H37Rv Rv1881c · MTBC0 mtbc0_001995 · 140 aa · 2149946–2150368 (-) · RefSeq NP_216397.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppE
MTBC0 PGAP re-annotationlipoprotein LpqH
Revised (this work)Lipoprotein LpqH. Pfam: Myco_19_kDa (PF05481.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07750 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable lipoprotein LppE

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelppE
eggNOG descriptionMycobacterium 19 kDa lipoprotein antigen
Orthologous group2BXAE
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Myco_19_kDaPF05481.18 1.3e-3027–140 Mycobacterium 19 kDa lipoprotein antigen

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp140 (cytochrome P450 Cyp140), high confidence from genomic context alone (score 799 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1880c cyp140 cytochrome P450 Cyp140 798 799 ctx neighborhood:796
Rv1883c hyp hypothetical protein 762 762 ctx neighborhood:751
Rv1882c short-chain type dehydrogenase/reductase 702 702 ctx neighborhood:688
Rv1884c rpfC resuscitation-promoting factor RpfC 551 550 ctx neighborhood:536
Rv1885c chorismate mutase 496 495 ctx neighborhood:488
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 471 472 ctx neighborhood:466
Rv1539 lspA lipoprotein signal peptidase 461 46 textmining:459

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppE
  • MTBC0 PGAP product: lipoprotein LpqH
  • Pfam (hmmscan --cut_ga): Myco_19_kDa PF05481.18 (E=1e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216397.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Myco_19_kDa (PF05481.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BXAE
  • Curated reference: UniProt O07750 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor cyp140
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001995|Rv1881c|lppE
MCNRLVTVTGVAMVVAAGLSACGQAQTVPRKAARLTIDGVTHTTRPATCSQEHSYRTIDIRNHDSTVQAVVLLSGDRVIPQWVKIRNVDGFNGSFWHGGVGNARADRARNTYTVAGSAYGISSKKPNTVVSTDFNILAEC