lppE Resolved · high auto-curated
H37Rv Rv1881c · MTBC0 mtbc0_001995 ·
140 aa · 2149946–2150368 (-) ·
RefSeq NP_216397.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LppE |
|---|---|
| MTBC0 PGAP re-annotation | lipoprotein LpqH |
| Revised (this work) | Lipoprotein LpqH. Pfam: Myco_19_kDa (PF05481.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07750
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable lipoprotein LppE |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | lppE |
| eggNOG description | Mycobacterium 19 kDa lipoprotein antigen |
| Orthologous group | 2BXAE |
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Myco_19_kDa | PF05481.18 | 1.3e-30 | 27–140 | Mycobacterium 19 kDa lipoprotein antigen |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cyp140 (cytochrome P450 Cyp140), high confidence from genomic context alone (score 799 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1880c cyp140 |
cytochrome P450 Cyp140 | 798 | 799 ctx | neighborhood:796 |
Rv1883c hyp |
hypothetical protein | 762 | 762 ctx | neighborhood:751 |
Rv1882c |
short-chain type dehydrogenase/reductase | 702 | 702 ctx | neighborhood:688 |
Rv1884c rpfC |
resuscitation-promoting factor RpfC | 551 | 550 ctx | neighborhood:536 |
Rv1885c |
chorismate mutase | 496 | 495 ctx | neighborhood:488 |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 471 | 472 ctx | neighborhood:466 |
Rv1539 lspA |
lipoprotein signal peptidase | 461 | 46 | textmining:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LppE
- MTBC0 PGAP product: lipoprotein LpqH
- Pfam (hmmscan --cut_ga): Myco_19_kDa PF05481.18 (E=1e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216397.1)
- Domains: Pfam-A via hmmscan --cut_ga — Myco_19_kDa (PF05481.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BXAE - Curated reference: UniProt O07750 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
cyp140 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001995|Rv1881c|lppE MCNRLVTVTGVAMVVAAGLSACGQAQTVPRKAARLTIDGVTHTTRPATCSQEHSYRTIDIRNHDSTVQAVVLLSGDRVIPQWVKIRNVDGFNGSFWHGGVGNARADRARNTYTVAGSAYGISSKKPNTVVSTDFNILAEC