Rv1883c Family assigned · medium auto-curated

H37Rv Rv1883c · MTBC0 mtbc0_001997 · 158 aa · 2151270–2151746 MTBC0 (-) · RefSeq NP_216399.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1871c (Rv1871c) — family_assigned: nitroreductase family deazaflavin-dependent oxidoreductase lldD2 (Rv1872c) — requalified: quinone-dependent L-lactate dehydrogenase lldD2 Rv1873 (Rv1873) — family_assigned: DUF1810 domain-containing protein Rv1875 (Rv1875) — requalified: PPOX class F420-dependent oxidoreductase Rv1877 (Rv1877) — family_assigned: MDR family MFS transporter Rv1877 glnA3 (Rv1878) — family_assigned: glutamine synthetase family protein glnA3 Rv1879 (Rv1879) — family_assigned: amidohydrolase family protein Rv1879 cyp140 (Rv1880c) — requalified: cytochrome P450 cyp140 lppE (Rv1881c) — requalified: lipoprotein LpqH Rv1882c (Rv1882c) — family_assigned: SDR family oxidoreductase Rv1882c Rv1883c (Rv1883c) — family_assigned: SRPBCC family protein rpfC (Rv1884c) — requalified: resuscitation-promoting factor RpfC Rv1885c (Rv1885c) — requalified: chorismate mutase fbpB (Rv1886c) — requalified: diacylglycerol acyltransferase/mycolyltransferase Ag85B fbpB Rv1887 (Rv1887) — family_assigned: hypothetical protein Rv1887 Rv1891 (Rv1891) — dark: hypothetical protein Rv1892 (Rv1892) — family_assigned: hypothetical protein Rv1893 (Rv1893) — family_assigned: hypothetical protein Rv1894c (Rv1894c) — family_assigned: nitronate monooxygenase family protein Rv1894c Rv1896c (Rv1896c) — requalified: class I SAM-dependent methyltransferase Rv1896c dtd (Rv1897c) — requalified: D-aminoacyl-tRNA deacylase Rv1898 (Rv1898) — family_assigned: MTH1187 family thiamine-binding protein 2 140 kb 2 144 kb 2 148 kb 2 152 kb 2 156 kb 2 160 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSRPBCC family protein
Revised (this work)SRPBCC family protein. Pfam: Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

Found under: H37Rv (1).

1 TB publication mentions this gene. 1 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Genome-Wide Study of Drug Resistant Mycobacterium tuberculosis and Its Intra-Host Evolution during Treatment. doi:10.3390/microorganisms10071440 2022

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.23 (95% CI -0.87 to 1.70). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1915c · 96.8% identity
M. leprae ML2031 · 76.2% identity
M. marinum MMAR_2771 · 81.3% identity
M. orygis RJtmp_001952 · 96.8% identity
M. abscessus MAB_3954c · 59.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O07748 TrEMBL · unreviewed · Evidence at protein level
UniProt nameCoenzyme Q-binding protein COQ10 START domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionpolyketide cyclase dehydrase
Orthologous groupCOG3832

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 80.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 39.2%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 7 growth-advantage. Saturation 1.000, mean read count 199. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance141.0 ppm · rank 1047/3519 (70.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length158 aa
Molecular weight17.8 kDa
Theoretical pI7.76
GRAVY-0.294 (hydrophilic)
Aliphatic index75.3
Aromaticity0.101
Instability index42.4 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Polyketide_cyc2PF10604.16 4.1e-1710–156 Polyketide cyclase / dehydrase and lipid transport
Polyketide_cycPF03364.26 6.6e-1415–144 Polyketide cyclase / dehydrase and lipid transport

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.5

PDB hitprobTM-scoreE-valueDescription
2m47-assembly1_A 1.00 0.64 5.8e-09 sig 2m47-assembly1_A Solution NMR structure of the Polyketide_cyc-like protein Cgl2372 from Corynebacterium glutamicum, Northeast Structural Genomics Consortium Target CgR160
4xrt-assembly1_A 1.00 0.73 6.4e-08 sig 4xrt-assembly1_A Crystal structure of the di-domain ARO/CYC StfQ from the steffimycin biosynthetic pathway
4xrt-assembly2_B 1.00 0.72 1.6e-07 sig 4xrt-assembly2_B Crystal structure of the di-domain ARO/CYC StfQ from the steffimycin biosynthetic pathway
7wa9-assembly1_A 1.00 0.79 7.9e-07 sig 7wa9-assembly1_A Crystal structure of MSMEG_5634 from Mycobacterium smegmatis
3rt0-assembly1_C 1.00 0.65 5.0e-08 sig 3rt0-assembly1_C Crystal structure of PYL10-HAB1 complex in the absence of abscisic acid (ABA)

Foldseek search of the AlphaFold DB model (mean pLDDT 90.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 7

Upstream (5' on genome)Rv1882c (- strand, 27 bp gap)
Downstream (3' on genome)rpfC (- strand, 38 bp gap)
Predicted operon cyp140 · lppE · Rv1882c · Rv1883c · rpfC · Rv1885c · fbpB

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (4 TF) Rv0023 (activates) · Rv0047c (represses) · Rv1990c (represses) · Rv2011c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rpfC (resuscitation-promoting factor RpfC), high confidence from genomic context alone (score 950 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1884c rpfC resuscitation-promoting factor RpfC 950 950 ctx neighborhood:692 coexpression:845
Rv1882c short-chain type dehydrogenase/reductase 866 866 ctx neighborhood:844
Rv1815 hyp hypothetical protein 798 798 coexpression:798
Rv1881c lppE lipoprotein LppE 762 762 ctx neighborhood:751
Rv0385 monooxygenase 760 732 coexpression:713
Rv1880c cyp140 cytochrome P450 Cyp140 699 698 ctx neighborhood:694
Rv1885c chorismate mutase 647 647 ctx neighborhood:642
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 636 636 ctx neighborhood:618
Rv3776 hyp hypothetical protein 523 523 ctx cooccurence:520
Rv0171 mce1C Mce family protein Mce1C 507 507 ctx cooccurence:485
Rv0515 hyp hypothetical protein 491 492 ctx cooccurence:484
Rv0336 hyp hypothetical protein 491 491 ctx cooccurence:484
Rv0172 mce1D Mce family protein Mce1D 490 490 ctx cooccurence:464
Rv0591 mce2C Mce family protein Mce2C 485 485 ctx cooccurence:482
Rv0174 mce1F Mce family protein Mce1F 461 462

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SRPBCC family protein
  • Pfam (hmmscan --cut_ga): Polyketide_cyc2 PF10604.16 (E=4e-17), Polyketide_cyc PF03364.26 (E=7e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216399.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3832
  • Curated reference: UniProt O07748 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor rpfC
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001997|Rv1883c|
MCLDQVMEGSATVHMAAPPDKIWTLIADVRNTGRFSPETFEAEWLDGATGPALGARFRGHVRRNGIGPVYWTVCEVTACEPGREFGFAVLLGDRPVNNWHYRLTPTADGTEVTESFRLPPSVLTTVYYRVFGGWLRQRRNIRDMTKTLQRIKDLVEAG