Rv0023 Family assigned · medium auto-curated

H37Rv Rv0023 · MTBC0 mtbc0_000028 · 256 aa · 27577–28347 (+) · RefSeq NP_214537.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationhelix-turn-helix transcriptional regulator
Revised (this work)Helix-turn-helix transcriptional regulator. Pfam: HTH_31 (PF13560.13), HTH_3 (PF01381.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMI3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized HTH-type transcriptional regulator Rv0023

UniProt still lists this protein as Uncharacterized HTH-type transcriptional regulator Rv0023; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionHelix-turn-helix
Orthologous groupCOG1396

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_31PF13560.13 7.8e-097–61 Helix-turn-helix domain
HTH_3PF01381.29 6.2e-1110–61 Helix-turn-helix

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0024 (NLP/P60 family protein), high confidence from genomic context alone (score 826 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0025 hyp hypothetical protein 833 833 ctx neighborhood:826
Rv0024 NLP/P60 family protein 825 826 ctx neighborhood:816
Rv0022c whiB5 transcriptional regulator WhiB5 773 773 ctx neighborhood:771
Rv0028 hyp hypothetical protein 670 670 ctx neighborhood:670
Rv0027 hyp hypothetical protein 670 670 ctx neighborhood:670
Rv0026 hyp hypothetical protein 511 512 ctx neighborhood:507
Rv0332 hyp hypothetical protein 500 473 experimental:434
Rv0366c hyp hypothetical protein 476 448 experimental:434
Rv3202c adnA ATP-dependent DNA helicase 531 70 textmining:517
Rv0081 HTH-type transcriptional regulator 541 63 textmining:531
Rv1657 argR arginine repressor 547 61 textmining:538
Rv2034 ArsR family HTH-type transcriptional repressor 502 58 textmining:493
Rv2506 TetR family transcriptional regulator 554 55 textmining:548
Rv3164c moxR3 methanol dehydrogenase transcriptional regulator MoxR 443 52 textmining:437
Rv1423 whiA transcriptional regulator WhiA 679 49 textmining:676

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: helix-turn-helix transcriptional regulator
  • Pfam (hmmscan --cut_ga): HTH_31 PF13560.13 (E=8e-09), HTH_3 PF01381.29 (E=6e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214537.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_31 (PF13560.13), HTH_3 (PF01381.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1396
  • Curated reference: UniProt P9WMI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor Rv0024
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000028|Rv0023|
MSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKPHKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSDTDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAGADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMWDIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ