fbpA Resolved · high auto-curated
H37Rv Rv3804c · MTBC0 mtbc0_004032 ·
338 aa ·
4289752–4290768 MTBC0
(-) ·
RefSeq NP_218321.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacylglycerol acyltransferase/mycolyltransferase Ag85A |
|---|---|
| MTBC0 PGAP re-annotation | diacylglycerol acyltransferase/mycolyltransferase Ag85A |
| Revised (this work) | Diacylglycerol acyltransferase/mycolyltransferase Ag85A. Pfam: Esterase (PF00756.27). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 47 publications
47 TB publications mention this gene. 47 publication(s) discuss this gene (45 in a M. tuberculosis context, 4 in other mycobacteria — M. leprae (2), M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Construction and characterization of novel Mycobacterium tuberculosis-derived triple and quadruple knockout vaccines against tuberculosis. doi:10.1128/iai.00500-25 | 2026 |
| Proteomic Analysis of Drug-Resistant Mycobacterium tuberculosis Clinical Isolates Under Aminoglycoside Drug Pressure. doi:10.1007/s00284-025-04341-8 | 2025 |
| Comparative Analysis of Virulence Genes in Non-Tuberculosis Mycobacteria (NTM) Isolated from Kenyan Camel Milk Suggests Potential Pathogenicity. doi:10.1007/s00284-025-04244-8 | 2025 |
| Long-term evaluation in BALBc mice of a triple mutant of Mycobacterium bovis and the Bacillus Calmette-Guérin as potential vaccines against bovine tuberculosis. doi:10.1016/j.vetmic.2025.110371 | 2025 |
| The ΔfbpAΔsapM candidate vaccine derived from Mycobacterium tuberculosis H37Rv is markedly immunogenic in macrophages and induces robust immunity to tuberculosis in mice. doi:10.3389/fimmu.2024.1321657 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 17% of residues (metapredict) · mean AlphaFold pLDDT 89.8 |
|---|---|
| Disordered regions | 2 IDR(s), longest 46 aa [0-46, 325-338] |
carries a substantial disordered region (59/338 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -0.82 (95% CI -3.85 to 3.51). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. |
|---|---|
| Mycobrowser EC |
2.3.1.-
· superseded EC numbering; the atlas uses the current class (2.3.1.122, 2.3.1.20)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3834c
· 100.0% identity |
|---|---|
| M. leprae |
ML0097
· 83.0% identity |
| M. marinum |
MMAR_5368
· 84.6% identity |
| M. smegmatis |
MSMEG_6398
· 68.8% identity |
| M. orygis |
RJtmp_003916
· 99.4% identity |
| M. abscessus |
MAB_0176
· 63.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQP3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Diacylglycerol acyltransferase/mycolyltransferase Ag85A |
| EC (curated) |
EC 2.3.1.122, EC 2.3.1.20
|
| Curated function | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation . |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | cmtB |
| eggNOG description | fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM |
| Orthologous group | COG0627 |
| EC number |
EC 2.3.1.122, EC 2.3.1.20
|
| KEGG orthology |
K18851
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (31) |
GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0008150 +19 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.524 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 82.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 43.9% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 51.6470588235. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call high-confidence target
Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Diacylglycerol acyltransferase/mycolyltransferase Ag85A. Pfam: Esterase (PF00756), which was derived independently from structure and orthology.
| Active / prioritized at | pH 6.6, pH 5.0 (growth condition) |
|---|---|
| Active under hypoxia | yes (non-replicating persistence relevant) |
| Covalent-inhibitor target | EZ120, CyC17 (chemically addressable active site) |
experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Ethambutol (drug exposure) | -5.21 | 0.0 | required |
| altered fitness under Meropenem (drug exposure) | -5.21 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +3.96 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | -3.43 | 0.0 | required |
| altered fitness under Ethambutol (drug exposure) | -3.36 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) | +3.07 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +2.75 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) | +2.53 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | +2.44 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +2.25 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | -2.21 | 0.0 | required |
| altered fitness under Vancomycin (drug exposure) | -2.10 | 0.011 | required |
Conditional fitness of transposon-disruption mutants across 13 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 3474.0 ppm · rank 28/3519 (99.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) signal peptide
| Prediction | predicted secreted protein (signal peptide) |
|---|---|
| DeepTMHMM class | SP |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 338 aa |
|---|---|
| Molecular weight | 35.7 kDa |
| Theoretical pI | 6.08 |
| GRAVY | -0.161 (hydrophilic) |
| Aliphatic index | 73.1 |
| Aromaticity | 0.101 |
| Instability index | 40.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Esterase | PF00756.27 | 8.7e-76 | 58–321 | Putative esterase |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1sfr |
X-ray diffraction | 2.7 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1sfr-assembly1_A |
1.00 | 0.98 | 4.4e-57 sig | 1sfr-assembly1_A Crystal Structure of the Mycobacterium tuberculosis Antigen 85A Protein |
1f0p-assembly1_A |
1.00 | 0.99 | 5.8e-53 sig | 1f0p-assembly1_A MYCOBACTERIUM TUBERCULOSIS ANTIGEN 85B WITH TREHALOSE |
3hrh-assembly1_B |
1.00 | 0.98 | 2.7e-43 sig | 3hrh-assembly1_B Crystal Structure of Antigen 85C and Glycerol |
1dqz-assembly1_B |
1.00 | 0.97 | 1.7e-43 sig | 1dqz-assembly1_B CRYSTAL STRUCTURE OF ANTIGEN 85C FROM MYCOBACTERIUM TUBERCULOSIS |
5vns-assembly1_A |
1.00 | 0.96 | 6.4e-42 sig | 5vns-assembly1_A M.tb Antigen 85C Acyl-Enzyme Intermediate with Tetrahydrolipstatin |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | fbpD (- strand, 179 bp gap) |
|---|---|
| Downstream (3' on genome) | aftB (- strand, 294 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
phoP (represses) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: aftB (terminal beta-(1->2)-arabinofuranosyltransferase), high confidence from genomic context alone (score 864 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0129c fbpC exp |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 974 | 903 | database:900 textmining:747 |
Rv1886c fbpB exp |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 952 | 902 | database:900 textmining:530 |
Rv3097c lipY exp |
triacylglycerol lipase Lip | 904 | 901 | database:900 |
Rv2252 dagK exp |
diacylglycerol kinase | 900 | 900 | database:900 |
Rv3805c aftB exp |
terminal beta-(1->2)-arabinofuranosyltransferase | 864 | 864 ctx | neighborhood:478 cooccurence:514 database:500 |
Rv1871c hyp |
hypothetical protein | 848 | 843 | coexpression:811 |
Rv3802c |
membrane protein | 833 | 808 ctx | cooccurence:702 |
Rv1872c lldD2 |
L-lactate dehydrogenase | 805 | 805 | coexpression:803 |
Rv0703 rplW |
50S ribosomal protein L23 | 805 | 805 | coexpression:805 |
Rv0685 tuf |
elongation factor Tu | 777 | 778 | coexpression:778 |
Rv0708 rplP |
50S ribosomal protein L16 | 744 | 744 | coexpression:744 |
Rv0702 rplD |
50S ribosomal protein L4 | 741 | 741 | coexpression:741 |
Rv1630 rpsA |
30S ribosomal protein S1 | 734 | 734 | coexpression:734 |
Rv0704 rplB |
50S ribosomal protein L2 | 733 | 733 | coexpression:733 |
Rv0705 rpsS |
30S ribosomal protein S19 | 732 | 732 | coexpression:732 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacylglycerol acyltransferase/mycolyltransferase Ag85A
- MTBC0 PGAP product: diacylglycerol acyltransferase/mycolyltransferase Ag85A
- Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=9e-76)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218321.1)
- Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0627 - Curated reference: UniProt P9WQP3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
86 functional partner(s); context anchor
aftB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004032|Rv3804c|fbpA MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for fbpA? Email the maintainer — the message is pre-filled with this gene's details.