Rv2252 Resolved · high auto-curated

H37Rv Rv2252 · MTBC0 mtbc0_002394 · 309 aa · 2553149–2554078 (+) · RefSeq NP_216768.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diacylglycerol kinase
MTBC0 PGAP re-annotationdiacylglycerol kinase
Revised (this work)Diacylglycerol kinase. Pfam: DAGK_cat (PF00781.30), YegS_C (PF19279.5).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP29 SwissProt · reviewed · Evidence at protein level
UniProt nameDiacylglycerol kinase
EC (curated) EC 2.7.1.107
Curated functionCatalyzes the phosphorylation of diacylglycerol (DAG) into phosphatidic acid. Is involved in the biosynthesis of phosphatidylinositol mannosides (PIMs), probably via a role in the biosynthesis of phosphatidylinositol (PI), a PIM precursor, which is derived from phosphatidic acid.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namedagK
eggNOG descriptionDiacylglycerol kinase
Orthologous groupCOG1597
EC number EC 2.7.1.107
KEGG orthology K07029
KEGG pathways map00561, map00564, map01100, map01110
Gene Ontology (35) GO:0003674, GO:0003824, GO:0004143, GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006643, GO:0006664, GO:0006793, GO:0006796, GO:0008150 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.389 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAGK_catPF00781.30 4.3e-2914–136 Diacylglycerol kinase catalytic domain
YegS_CPF19279.5 4.0e-42149–304 YegS C-terminal NAD kinase beta sandwich-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2251 (flavoprotein), high confidence from genomic context alone (score 973 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2251 flavoprotein 976 973 ctx neighborhood:799 coexpression:831
Rv2250A Possible flavoprotein; Rv2250A, len: 139 aa. Conserved hypothetical protein, possibly flavoprotein. Similar to N-terminus of SCF91.28c|AL132 968 964 ctx neighborhood:799 coexpression:759
Rv2249c glpD1 glycerol-3-phosphate dehydrogenase 960 958 ctx neighborhood:788 database:800
Rv3097c lipY triacylglycerol lipase Lip 906 907 database:900
Rv2881c cdsA phosphatidate cytidylyltransferase 957 904 database:900 textmining:573
Rv2182c 1-acylglycerol-3-phosphate O-acyltransferase 906 903 database:900
Rv3087 diacyglycerol O-acyltransferase 903 903 database:900
Rv2484c diacyglycerol O-acyltransferase 902 903 database:900
Rv3480c diacyglycerol O-acyltransferase 902 903 database:900
Rv2285 diacylglycerol acyltransferase 902 903 database:900
Rv2351c plcA membrane-associated phospholipase A 902 902 database:900
Rv2349c plcC phospholipase C 900 901 database:900
Rv3740c diacyglycerol O-acyltransferase 900 901 database:900
Rv2350c plcB membrane-associated phospholipase B 900 901 database:900
Rv1425 diacyglycerol O-acyltransferase 900 901 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: diacylglycerol kinase
  • MTBC0 PGAP product: diacylglycerol kinase
  • Pfam (hmmscan --cut_ga): DAGK_cat PF00781.30 (E=4e-29), YegS_C PF19279.5 (E=4e-42)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216768.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAGK_cat (PF00781.30), YegS_C (PF19279.5)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1597
  • Curated reference: UniProt P9WP29 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor Rv2251
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002394|Rv2252|
MSAGQLRRHEIGKVTALTNPLSGHGAAVKAAHGAIARLKHRGVDVVEIVGGDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAGTGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQDDNGIEKWFGTVAATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEIVADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSRTKLLRLFPTIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAALQVLRPRHG