Rv2252 Resolved · high auto-curated
H37Rv Rv2252 · MTBC0 mtbc0_002394 ·
309 aa · 2553149–2554078 (+) ·
RefSeq NP_216768.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacylglycerol kinase |
|---|---|
| MTBC0 PGAP re-annotation | diacylglycerol kinase |
| Revised (this work) | Diacylglycerol kinase. Pfam: DAGK_cat (PF00781.30), YegS_C (PF19279.5). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WP29
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Diacylglycerol kinase |
| EC (curated) |
EC 2.7.1.107
|
| Curated function | Catalyzes the phosphorylation of diacylglycerol (DAG) into phosphatidic acid. Is involved in the biosynthesis of phosphatidylinositol mannosides (PIMs), probably via a role in the biosynthesis of phosphatidylinositol (PI), a PIM precursor, which is derived from phosphatidic acid. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | dagK |
| eggNOG description | Diacylglycerol kinase |
| Orthologous group | COG1597 |
| EC number |
EC 2.7.1.107
|
| KEGG orthology |
K07029
|
| KEGG pathways |
map00561, map00564, map01100, map01110
|
| Gene Ontology (35) |
GO:0003674, GO:0003824, GO:0004143, GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006643, GO:0006664, GO:0006793, GO:0006796, GO:0008150 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.389 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DAGK_cat | PF00781.30 | 4.3e-29 | 14–136 | Diacylglycerol kinase catalytic domain |
YegS_C | PF19279.5 | 4.0e-42 | 149–304 | YegS C-terminal NAD kinase beta sandwich-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2251 (flavoprotein), high confidence from genomic context alone (score 973 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2251 |
flavoprotein | 976 | 973 ctx | neighborhood:799 coexpression:831 |
Rv2250A |
Possible flavoprotein; Rv2250A, len: 139 aa. Conserved hypothetical protein, possibly flavoprotein. Similar to N-terminus of SCF91.28c|AL132 | 968 | 964 ctx | neighborhood:799 coexpression:759 |
Rv2249c glpD1 |
glycerol-3-phosphate dehydrogenase | 960 | 958 ctx | neighborhood:788 database:800 |
Rv3097c lipY |
triacylglycerol lipase Lip | 906 | 907 | database:900 |
Rv2881c cdsA |
phosphatidate cytidylyltransferase | 957 | 904 | database:900 textmining:573 |
Rv2182c |
1-acylglycerol-3-phosphate O-acyltransferase | 906 | 903 | database:900 |
Rv3087 |
diacyglycerol O-acyltransferase | 903 | 903 | database:900 |
Rv2484c |
diacyglycerol O-acyltransferase | 902 | 903 | database:900 |
Rv3480c |
diacyglycerol O-acyltransferase | 902 | 903 | database:900 |
Rv2285 |
diacylglycerol acyltransferase | 902 | 903 | database:900 |
Rv2351c plcA |
membrane-associated phospholipase A | 902 | 902 | database:900 |
Rv2349c plcC |
phospholipase C | 900 | 901 | database:900 |
Rv3740c |
diacyglycerol O-acyltransferase | 900 | 901 | database:900 |
Rv2350c plcB |
membrane-associated phospholipase B | 900 | 901 | database:900 |
Rv1425 |
diacyglycerol O-acyltransferase | 900 | 901 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacylglycerol kinase
- MTBC0 PGAP product: diacylglycerol kinase
- Pfam (hmmscan --cut_ga): DAGK_cat PF00781.30 (E=4e-29), YegS_C PF19279.5 (E=4e-42)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216768.1)
- Domains: Pfam-A via hmmscan --cut_ga — DAGK_cat (PF00781.30), YegS_C (PF19279.5)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1597 - Curated reference: UniProt P9WP29 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
37 functional partner(s); context anchor
Rv2251 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002394|Rv2252| MSAGQLRRHEIGKVTALTNPLSGHGAAVKAAHGAIARLKHRGVDVVEIVGGDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAGTGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQDDNGIEKWFGTVAATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEIVADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSRTKLLRLFPTIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAALQVLRPRHG