rpfC Resolved · high auto-curated

H37Rv Rv1884c · MTBC0 mtbc0_001998 · 176 aa · 2151785–2152315 (-) · RefSeq NP_216400.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)resuscitation-promoting factor RpfC
MTBC0 PGAP re-annotationresuscitation-promoting factor RpfC
Revised (this work)Resuscitation-promoting factor RpfC. Pfam: Transglycosylas (PF06737.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07747 SwissProt · reviewed · Evidence at protein level
UniProt nameResuscitation-promoting factor RpfC
EC (curated) EC 3.-.-.-
Curated functionFactor that stimulates resuscitation of dormant cells. Has peptidoglycan (PG) hydrolytic activity. Active in the pM concentration range. Has little to no effect on actively-growing cells. PG fragments could either directly activate the resuscitation pathway of dormant bacteria or serve as a substrate for endogenous Rpf, resulting in low molecular weight products with resuscitation activity..; FUNCTION: Stimulates growth of stationary phase M.bovis (a slow-growing Mycobacterium), reduces the lag phase of diluted fast-growers M.smegmatis and Micrococcus luteus. Sequential gene disruption indicat.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namerpfC
eggNOG descriptionTransglycosylase-like domain
Orthologous groupCOG1652
KEGG orthology K21689
Gene Ontology (20) GO:0005575, GO:0005576, GO:0008150, GO:0009892, GO:0009893, GO:0010468, GO:0010604, GO:0010605, GO:0010628, GO:0010629, GO:0019222, GO:0040008 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.224 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (243) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TransglycosylasPF06737.20 8.8e-3470–140 Transglycosylase-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1885c (chorismate mutase), high confidence from genomic context alone (score 765 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1883c hyp hypothetical protein 950 950 ctx neighborhood:692 coexpression:845
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 881 881 coexpression:490 experimental:769
Rv1815 hyp hypothetical protein 808 768 coexpression:765
Rv1885c chorismate mutase 846 765 ctx neighborhood:762
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 791 744 ctx neighborhood:736
Rv1882c short-chain type dehydrogenase/reductase 658 648 ctx neighborhood:606
Rv1881c lppE lipoprotein LppE 551 550 ctx neighborhood:536
Rv0007 membrane protein 500 500 coexpression:500
Rv3268 hyp hypothetical protein 477 477 ctx cooccurence:474
Rv1880c cyp140 cytochrome P450 Cyp140 471 471 ctx neighborhood:464
Rv0925c hyp hypothetical protein 472 447 coexpression:446
Rv3669 transmembrane protein 446 447
Rv2771c hyp hypothetical protein 468 443 coexpression:442
Rv0819 mshD mycothiol acetyltransferase 453 433 ctx cooccurence:417
Rv2466c hyp hypothetical protein 430 430 ctx cooccurence:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: resuscitation-promoting factor RpfC
  • MTBC0 PGAP product: resuscitation-promoting factor RpfC
  • Pfam (hmmscan --cut_ga): Transglycosylas PF06737.20 (E=9e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216400.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Transglycosylas (PF06737.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1652
  • Curated reference: UniProt O07747 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor Rv1885c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001998|Rv1884c|rpfC
MHPLPADHGRSRCNRHPISPLSLIGNASATSGDMSSMTRIAKPLIKSAMAAGLVTASMSLSTAVAHAGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAASGLPIALWSKPAQGIKQIINEIIWAGIQASIPR