ripC Resolved · high auto-curated

H37Rv Rv2190c · MTBC0 mtbc0_002325 · 385 aa · 2478122–2479279 (-) · RefSeq NP_216706.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)endopeptidase
MTBC0 PGAP re-annotationpeptidoglycan hydrolase RipC
Revised (this work)Peptidoglycan hydrolase RipC. Pfam: NLPC_P60 (PF00877.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHU3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable endopeptidase Rv2190c
EC (curated) EC 3.4.-.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionNlpC/P60 family
Orthologous groupCOG0791
KEGG orthology K21471
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.043 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NLPC_P60PF00877.26 3.7e-23285–368 NlpC/P60 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pimB (alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase), medium confidence from genomic context alone (score 608 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0950c hyp hypothetical protein 882 795 coexpression:761 textmining:453
Rv2189c hyp hypothetical protein 798 791 ctx neighborhood:752
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 781 757 coexpression:757
Rv1010 ksgA rRNA small subunit methyltransferase A 738 738 coexpression:730
Rv0175 Mce associated membrane protein 732 732 coexpression:732
Rv2188c pimB alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase 706 608 ctx neighborhood:551
Rv0018c pstP phosphoserine/threonine phosphatase PstP 596 596 ctx cooccurence:582
Rv3835 hyp hypothetical protein 577 578 ctx cooccurence:575
Rv3909 hyp hypothetical protein 595 565 ctx cooccurence:561
Rv1024 membrane protein 434 434 ctx cooccurence:426
Rv0007 membrane protein 422 422 ctx cooccurence:403
Rv1009 rpfB resuscitation-promoting factor RpfB 727 400 textmining:565
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 419 398
Rv1478 ripB peptidoglycan endopeptidase RipB 480 359
Rv1477 ripA peptidoglycan endopeptidase RipA 557 358

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: endopeptidase
  • MTBC0 PGAP product: peptidoglycan hydrolase RipC
  • Pfam (hmmscan --cut_ga): NLPC_P60 PF00877.26 (E=4e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216706.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NLPC_P60 (PF00877.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0791
  • Curated reference: UniProt P9WHU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor pimB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002325|Rv2190c|ripC
MRLDQRWLIARVIMRSAIGFFASFTVSSGVLAANVLADPADDALAKLNELSRQAEQTTEALHSAQLDLNEKLAAQRAADQKLADNRTALDAARARLATFQTAVNKVAAATYMGGRTHGMDAILTAESPQLLIDRLSVQRVMAHQMSTQMARFKAAGEQAVKAEQAAAKSAADARSAAEQAAAVRANLQHKQSQLQVQIAVVKSQYVALTPEERTALADPGPVPAVAAIAPGAPPAALPPGAPPGDGPAPGVAPPPGGMPGLPFVQPDGAGGDRTAVVQAALTQVGAPYAWGGAAPGGFDCSGLVMWAFQQAGIALPHSSQALAHGGQPVALSDLQPGDVLTFYSDASHAGIYIGDGLMVHSSTYGVPVRVVPMDSSGPIYDARRY