ripC Resolved · high auto-curated
H37Rv Rv2190c · MTBC0 mtbc0_002325 ·
385 aa ·
2478122–2479279 MTBC0
(-) ·
RefSeq NP_216706.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | endopeptidase |
|---|---|
| MTBC0 PGAP re-annotation | peptidoglycan hydrolase RipC |
| Revised (this work) | Peptidoglycan hydrolase RipC. Pfam: NLPC_P60 (PF00877.26). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (6 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (2), M. leprae (1)).
| Publication | Date |
|---|---|
| Mycobacterial FtsEX-RipC interaction is required for normal growth and cell morphology in rifampicin and low ionic strength conditions. doi:10.1128/spectrum.02515-23 | 2024 |
| Regulation of the cell division hydrolase RipC by the FtsEX system in Mycobacterium tuberculosis. doi:10.1038/s41467-023-43770-6 | 2023 |
| Recombinant polypeptide of Mycobacterium leprae as a potential tool for serological detection of leprosy. doi:10.1186/s13568-019-0928-9 | 2019 |
| Identification of new components of the RipC-FtsEX cell separation pathway of Corynebacterineae. doi:10.1371/journal.pgen.1008284 | 2019 |
| Immunogenicity and therapeutic effects of a Mycobacterium tuberculosis rv2190c DNA vaccine in mice. doi:10.1186/s12865-017-0196-x | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 24% of residues (metapredict) · mean AlphaFold pLDDT 81.6 |
|---|---|
| Disordered regions | 2 IDR(s), longest 57 aa [0-37, 214-271] |
carries a substantial disordered region (94/385 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -2.25 (95% CI -4.21 to 0.71). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2213c
· 99.7% identity |
|---|---|
| M. leprae |
ML0885
· 66.2% identity |
| M. marinum |
MMAR_3234
· 79.3% identity |
| M. smegmatis |
MSMEG_4256
· 62.3% identity |
| M. orygis |
RJtmp_002260
· 99.7% identity |
| M. abscessus |
MAB_1974
· 53.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHU3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable endopeptidase Rv2190c |
| EC (curated) |
EC 3.4.-.-
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| eggNOG description | NlpC/P60 family |
| Orthologous group | COG0791 |
| KEGG orthology |
K21471
|
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.043 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.116 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 38/53 (72%) · mean identity 75.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 38/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 38.3% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 20 in the ORF — 0 in the essential state, 0 growth-defect, 20 non-essential, 0 growth-advantage. Saturation 0.950, mean read count 181.263157895. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv2190c-TetOn 18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 4.465 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -7.42 | 0.0 | required |
| fitness in mouse infection (in vivo) | +3.79 | 0.0 | disruption advantageous |
| altered fitness under Ethambutol (drug exposure) | -3.03 | 0.0 | required |
| altered fitness under Vancomycin (drug exposure) | -2.87 | 0.0 | required |
| altered fitness under Ethambutol (drug exposure) | -2.44 | 0.0 | required |
| altered fitness under Rifampicin (drug exposure) | -1.87 | 0.0067 | required |
| fitness in mouse infection, day 45 (in vivo) | -1.73 | 0.035 | required |
Conditional fitness of transposon-disruption mutants across 7 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 17.1 ppm · rank 2420/3519 (31.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) signal peptide
| Prediction | predicted secreted protein (signal peptide) |
|---|---|
| DeepTMHMM class | SP |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 385 aa |
|---|---|
| Molecular weight | 39.8 kDa |
| Theoretical pI | 6.24 |
| GRAVY | -0.01 (hydrophilic) |
| Aliphatic index | 85.4 |
| Aromaticity | 0.052 |
| Instability index | 47.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NLPC_P60 | PF00877.26 | 3.7e-23 | 285–368 | NlpC/P60 family |
Experimental structures (Protein Data Bank) 4 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8idc |
Electron Microscopy | 3.9 Å | 100% |
8jia |
Electron Microscopy | 3.9 Å | 100% |
8idd |
Electron Microscopy | 4.0 Å | 100% |
8igq |
Electron Microscopy | 5.7 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 81.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8idc-assembly1_E |
1.00 | 0.87 | 6.9e-33 sig | 8idc-assembly1_E Cryo-EM structure of Mycobacterium tuberculosis FtsEX/RipC complex in peptidisc |
8jia-assembly1_E |
1.00 | 0.85 | 1.4e-24 sig | 8jia-assembly1_E Cryo-EM structure of Mycobacterium tuberculosis ATP bound FtsE(E165Q)X/RipC complex in peptidisc |
8v3w-assembly1_b |
1.00 | 0.92 | 2.1e-09 sig | 8v3w-assembly1_b CryoEM Structure of Diffocin - precontracted - Baseplate - focused refinement on triplex region |
8er5-assembly1_B |
1.00 | 0.85 | 8.6e-10 sig | 8er5-assembly1_B Crystal Structure of NlpC/P60 domain from Clostridium innocuum NlpC/P60 domain-containing protein CI_01448. |
8aud-assembly1_A |
1.00 | 0.43 | 3.1e-11 sig | 8aud-assembly1_A Structure of peptidoglycan hydrolase Cg1735 from Corynebacterium glutamicum, orthorhombic crystal form |
Foldseek search of the AlphaFold DB model (mean pLDDT 81.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2189c (- strand, 94 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2191 (+ strand, 546 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pimB (alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase), medium confidence from genomic context alone (score 608 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0950c hyp |
hypothetical protein | 882 | 795 | coexpression:761 textmining:453 |
Rv2189c hyp |
hypothetical protein | 798 | 791 ctx | neighborhood:752 |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 781 | 757 | coexpression:757 |
Rv1010 ksgA |
rRNA small subunit methyltransferase A | 738 | 738 | coexpression:730 |
Rv0175 |
Mce associated membrane protein | 732 | 732 | coexpression:732 |
Rv2188c pimB |
alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase | 706 | 608 ctx | neighborhood:551 |
Rv0018c pstP |
phosphoserine/threonine phosphatase PstP | 596 | 596 ctx | cooccurence:582 |
Rv3835 hyp |
hypothetical protein | 577 | 578 ctx | cooccurence:575 |
Rv3909 hyp |
hypothetical protein | 595 | 565 ctx | cooccurence:561 |
Rv1024 |
membrane protein | 434 | 434 ctx | cooccurence:426 |
Rv0007 |
membrane protein | 422 | 422 ctx | cooccurence:403 |
Rv1009 rpfB |
resuscitation-promoting factor RpfB | 727 | 400 | textmining:565 |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 419 | 398 | |
Rv1478 ripB |
peptidoglycan endopeptidase RipB | 480 | 359 | |
Rv1477 ripA |
peptidoglycan endopeptidase RipA | 557 | 358 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: endopeptidase
- MTBC0 PGAP product: peptidoglycan hydrolase RipC
- Pfam (hmmscan --cut_ga): NLPC_P60 PF00877.26 (E=4e-23)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216706.1)
- Domains: Pfam-A via hmmscan --cut_ga — NLPC_P60 (PF00877.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0791 - Curated reference: UniProt P9WHU3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 81.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
pimB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002325|Rv2190c|ripC MRLDQRWLIARVIMRSAIGFFASFTVSSGVLAANVLADPADDALAKLNELSRQAEQTTEALHSAQLDLNEKLAAQRAADQKLADNRTALDAARARLATFQTAVNKVAAATYMGGRTHGMDAILTAESPQLLIDRLSVQRVMAHQMSTQMARFKAAGEQAVKAEQAAAKSAADARSAAEQAAAVRANLQHKQSQLQVQIAVVKSQYVALTPEERTALADPGPVPAVAAIAPGAPPAALPPGAPPGDGPAPGVAPPPGGMPGLPFVQPDGAGGDRTAVVQAALTQVGAPYAWGGAAPGGFDCSGLVMWAFQQAGIALPHSSQALAHGGQPVALSDLQPGDVLTFYSDASHAGIYIGDGLMVHSSTYGVPVRVVPMDSSGPIYDARRY
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ripC? Email the maintainer — the message is pre-filled with this gene's details.